GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-15 05:57:09, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_032581442            1000 bp    mRNA    linear   VRT 24-FEB-2020
DEFINITION  PREDICTED: Xiphophorus hellerii gastrula zinc finger protein
            XlCGF8.2DB-like (LOC116731626), mRNA.
ACCESSION   XM_032581442
VERSION     XM_032581442.1
DBLINK      BioProject: PRJNA604828
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Xiphophorus hellerii (green swordtail)
  ORGANISM  Xiphophorus hellerii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Ovalentaria; Atherinomorphae; Cyprinodontiformes;
            Poeciliidae; Poeciliinae; Xiphophorus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_045684.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xiphophorus hellerii Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 3% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1000
                     /organism="Xiphophorus hellerii"
                     /mol_type="mRNA"
                     /strain="12219"
                     /db_xref="taxon:8084"
                     /chromosome="13"
                     /sex="male"
                     /tissue_type="muscle"
                     /dev_stage="adult"
     gene            1..1000
                     /gene="LOC116731626"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins, and 88% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:116731626"
     CDS             38..1000
                     /gene="LOC116731626"
                     /codon_start=1
                     /product="gastrula zinc finger protein XlCGF8.2DB-like"
                     /protein_id="XP_032437333.1"
                     /db_xref="GeneID:116731626"
                     /translation="
MMIHTGEKPFSCVNCGKRFSRKDELTKHMMIHTGEKPFSCVNCGKIFSQKQNLTKHMMIHTGEKPFSCVNCGKIFSQKQNLTKHMMIHTGEKPFSCVNCGKRFSRKDELTKHMMIHTGEKPFSCVNCGKRFSRKDELTKHMMIHTGEKPFSCVNCGKRFSRKDELTKHMMIHTGEKPFSCVNCGKSFSRKQHLTGHMRTHTGEKPFSCVTCGKSFSHKQNLTRHMMIHTVEKPFSCVNCGKGFSQKQELAQHMMIHTSEKPFSCGNCGKCFYRKQYLTQHMMIHTGEKPFLCVNCGKSFSRKQHLTQHMSVTLSIVEYQG"
     misc_feature    71..133
                     /gene="LOC116731626"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    155..217
                     /gene="LOC116731626"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    <179..760
                     /gene="LOC116731626"
                     /note="FOG: Zn-finger [General function prediction only];
                     Region: COG5048"
                     /db_xref="CDD:227381"
     misc_feature    239..301
                     /gene="LOC116731626"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    323..385
                     /gene="LOC116731626"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(338..340,344..346,350..352,356..361,368..373,
                     380..382,422..424,428..430,440..445,452..457,464..466,
                     506..508,512..514,518..520,524..529,536..541,548..550)
                     /gene="LOC116731626"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    407..469
                     /gene="LOC116731626"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    491..553
                     /gene="LOC116731626"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    575..637
                     /gene="LOC116731626"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    659..721
                     /gene="LOC116731626"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    743..805
                     /gene="LOC116731626"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    827..889
                     /gene="LOC116731626"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    911..964
                     /gene="LOC116731626"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
ORIGIN      
aaaaagttttcgtcgaaaacagcatttaactaagcacatgatgattcacacaggtgaaaagccgttttcatgtgtgaactgtggaaagagatttagtcgaaaagatgagttaactaagcatatgatgattcacactggtgaaaagccgttttcatgtgtgaactgtggaaaaatttttagtcaaaaacagaatttaactaagcacatgatgattcacactggtgaaaagccgttttcatgtgtgaactgtggaaaaatttttagtcaaaaacagaatttaactaagcacatgatgattcacacaggtgaaaagccgttttcatgtgtgaactgtggaaagagatttagtcgaaaagatgagttaactaagcatatgatgattcacactggtgaaaagccgttttcatgtgtgaactgtggaaagagatttagtcgaaaagatgagttaactaagcatatgatgattcacactggtgaaaagccgttttcatgtgtgaactgtggaaagagatttagtcgaaaagatgagttaactaagcacatgatgattcacactggtgaaaagccgttttcatgtgtgaactgtggaaaaagttttagtcgaaaacagcatttaactggacacatgagaactcatacaggtgaaaagccgttttcatgtgtgacctgtggaaaaagttttagtcacaaacagaatttaactcggcacatgatgatccacactgttgaaaagcctttttcatgtgtgaactgtggaaaaggttttagtcaaaaacaggagttagctcagcacatgatgattcacaccagtgaaaagccattctcatgtgggaactgtggaaaatgtttttatcgaaaacagtatttaactcagcacatgatgattcacactggtgaaaagccgtttttatgtgtgaactgtggaaaaagttttagtcgaaaacagcatttaactcagcacatgagtgtgacactcagcattgtcgagtaccaaggttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]