2024-05-08 10:59:00, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_031838906 787 bp mRNA linear VRT 16-DEC-2019 DEFINITION PREDICTED: Anarrhichthys ocellatus mitochondrial ribosomal protein L49 (mrpl49), mRNA. ACCESSION XM_031838906 VERSION XM_031838906.1 DBLINK BioProject: PRJNA595352 KEYWORDS RefSeq. SOURCE Anarrhichthys ocellatus (wolf-eel) ORGANISM Anarrhichthys ocellatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Perciformes; Cottioidei; Zoarcales; Anarhichadidae; Anarrhichthys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_022281076.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Anarrhichthys ocellatus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.3 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..787 /organism="Anarrhichthys ocellatus" /mol_type="mRNA" /isolate="YVR2014" /db_xref="taxon:433405" /chromosome="Unknown" /sex="female" /tissue_type="blood" /dev_stage="adult" gene 1..787 /gene="mrpl49" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:116377296" CDS 40..573 /gene="mrpl49" /codon_start=1 /product="39S ribosomal protein L49, mitochondrial" /protein_id="XP_031694766.1" /db_xref="GeneID:116377296" /translation="
MAARYTTQSTGVRRALRALSLYIRSPGPPAAAVGLRFVCNNAPEEKTRVGSESTEEYRFVEGLIPPSRVPAPPKHAGSSPSGWTPPADTPPPLPYMIRRSRMHNIPVYTDLTHGSRRTTLVRKVEGDIWALEKDVKQYLKEVMGKELPTQVNEVTMTLKVKGHVDSELKEWLASKGF"
misc_feature 322..570 /gene="mrpl49" /note="Mitochondrial large subunit ribosomal protein (Img2); Region: Img2; pfam05046" /db_xref="CDD:428279" ORIGIN
tgtaaactcggaagcagcagcagcagcctgcttcacaagatggcggcccgctacaccactcagtctactggggtccgcagggcgctgcgagccctcagcctttacatccggtcaccaggacctcctgccgcggctgtcgggctcaggtttgtttgtaacaatgctccagaagaaaaaacgagggtgggatcagaatctacggaggaatacaggttcgtagaggggctcatcccgccgtcacgggtccccgctccgcctaaacacgccggctcttccccgtctggctggacccctccggcagatacaccgccgcctctgccctacatgatccgccgctcccgtatgcacaacatcccggtttacaccgatctgacccacggcagccgcaggacaacgctcgtgcggaaagtggagggggacatctgggctctggagaaggacgtgaagcaatatctgaaggaggtgatggggaaggagctgcccacgcaggtcaacgaggtcacaatgaccttgaaggtcaagggtcatgtcgacagtgagctgaaggagtggttggccagcaagggcttctgactgcgggggtgagggggcgctgagcctccagggccagagagacgtgcaggtggagacggaggaccaccttgaaacattgtcctacagcacatttaaaccatttcaatccatatggactactgacactgaactgaactctctccagacaccggagagatgttgacgggttgttaaacatacttgtatgtaatgaacataaaagcgttgcccactt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]