GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-08 10:59:00, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_031838906             787 bp    mRNA    linear   VRT 16-DEC-2019
DEFINITION  PREDICTED: Anarrhichthys ocellatus mitochondrial ribosomal protein
            L49 (mrpl49), mRNA.
ACCESSION   XM_031838906
VERSION     XM_031838906.1
DBLINK      BioProject: PRJNA595352
KEYWORDS    RefSeq.
SOURCE      Anarrhichthys ocellatus (wolf-eel)
  ORGANISM  Anarrhichthys ocellatus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Eupercaria; Perciformes; Cottioidei; Zoarcales;
            Anarhichadidae; Anarrhichthys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_022281076.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Anarrhichthys ocellatus Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..787
                     /organism="Anarrhichthys ocellatus"
                     /mol_type="mRNA"
                     /isolate="YVR2014"
                     /db_xref="taxon:433405"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="adult"
     gene            1..787
                     /gene="mrpl49"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 9 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:116377296"
     CDS             40..573
                     /gene="mrpl49"
                     /codon_start=1
                     /product="39S ribosomal protein L49, mitochondrial"
                     /protein_id="XP_031694766.1"
                     /db_xref="GeneID:116377296"
                     /translation="
MAARYTTQSTGVRRALRALSLYIRSPGPPAAAVGLRFVCNNAPEEKTRVGSESTEEYRFVEGLIPPSRVPAPPKHAGSSPSGWTPPADTPPPLPYMIRRSRMHNIPVYTDLTHGSRRTTLVRKVEGDIWALEKDVKQYLKEVMGKELPTQVNEVTMTLKVKGHVDSELKEWLASKGF"
     misc_feature    322..570
                     /gene="mrpl49"
                     /note="Mitochondrial large subunit ribosomal protein
                     (Img2); Region: Img2; pfam05046"
                     /db_xref="CDD:428279"
ORIGIN      
tgtaaactcggaagcagcagcagcagcctgcttcacaagatggcggcccgctacaccactcagtctactggggtccgcagggcgctgcgagccctcagcctttacatccggtcaccaggacctcctgccgcggctgtcgggctcaggtttgtttgtaacaatgctccagaagaaaaaacgagggtgggatcagaatctacggaggaatacaggttcgtagaggggctcatcccgccgtcacgggtccccgctccgcctaaacacgccggctcttccccgtctggctggacccctccggcagatacaccgccgcctctgccctacatgatccgccgctcccgtatgcacaacatcccggtttacaccgatctgacccacggcagccgcaggacaacgctcgtgcggaaagtggagggggacatctgggctctggagaaggacgtgaagcaatatctgaaggaggtgatggggaaggagctgcccacgcaggtcaacgaggtcacaatgaccttgaaggtcaagggtcatgtcgacagtgagctgaaggagtggttggccagcaagggcttctgactgcgggggtgagggggcgctgagcctccagggccagagagacgtgcaggtggagacggaggaccaccttgaaacattgtcctacagcacatttaaaccatttcaatccatatggactactgacactgaactgaactctctccagacaccggagagatgttgacgggttgttaaacatacttgtatgtaatgaacataaaagcgttgcccactt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]