2024-04-24 06:34:09, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_029888794 285 bp mRNA linear PLN 12-JUL-2019 DEFINITION Pyricularia pennisetigena uncharacterized protein (PpBr36_01609), partial mRNA. ACCESSION XM_029888794 VERSION XM_029888794.1 DBLINK BioProject: PRJNA554126 BioSample: SAMN10496236 KEYWORDS RefSeq. SOURCE Pyricularia pennisetigena ORGANISM Pyricularia pennisetigena Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Sordariomycetidae; Magnaporthales; Pyriculariaceae; Pyricularia. REFERENCE 1 (bases 1 to 285) AUTHORS Gomez Luciano,L.B., Jason Tsai,I., Chuma,I., Tosa,Y., Chen,Y.H., Li,J.Y., Li,M.Y., Jade Lu,M.Y., Nakayashiki,H. and Li,W.H. TITLE Blast fungal genomes show frequent chromosomal changes, gene gains and losses, and effector gene turnover JOURNAL Mol. Biol. Evol. (2019) In press PUBMED 30835262 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 285) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (12-JUL-2019) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 285) AUTHORS Gomez Luciano,L.B., Tsai,I.J., Chuma,I., Tosa,Y., Lu,M.-Y.J., Nakayashiki,H. and Li,W.-H. TITLE Direct Submission JOURNAL Submitted (29-NOV-2018) Biodiversity Research Center, Academia Sinica, 128 Academia Road, Sec. 2, Nankang, Taipei 11529, Taiwan COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_043741). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..285 /organism="Pyricularia pennisetigena" /mol_type="mRNA" /strain="Br36" /host="Cenchrus echinatus" /db_xref="taxon:1578925" /chromosome="2" /country="Brazil: Parana" /collection_date="1990" gene <1..>285 /locus_tag="PpBr36_01609" /db_xref="GeneID:40731099" CDS 1..285 /locus_tag="PpBr36_01609" /codon_start=1 /product="hypothetical protein" /protein_id="XP_029750761.1" /db_xref="GeneID:40731099" /translation="
MTSVVPHKCGDNGGFRCAKPPRPSPGSTVQPNGTPCEVLQKPISHPILHEGSNSPHDVPASFSGSGWIAETNKDEVIVTCRSLVHHRAKPHSVR"
ORIGIN
atgacatcagtggtcccacacaagtgtggcgacaatggagggttccgctgcgccaagcccccccggccttctcccggcagtacagtacaaccaaacggaacgccatgcgaggtgttgcaaaagccgatttcccatcccatcctgcacgaagggtccaactcgcctcatgacgttcccgcctccttcagcggtagcggttggatcgccgagacaaacaaggacgaggtcatcgtgacctgccgcagcttagtacaccaccgcgccaaacctcattcagttcgttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]