GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2022-01-26 16:18:12, GGRNA.v2 : RefSeq release 209 (Nov, 2021)

LOCUS       XM_029173678            1978 bp    mRNA    linear   VRT 24-APR-2021
DEFINITION  PREDICTED: Betta splendens claudin-3-like (LOC114869437), mRNA.
ACCESSION   XM_029173678
VERSION     XM_029173678.2
DBLINK      BioProject: PRJNA522468
KEYWORDS    RefSeq.
SOURCE      Betta splendens (Siamese fighting fish)
  ORGANISM  Betta splendens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Anabantaria; Anabantiformes; Anabantoidei;
            Osphronemidae; Betta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_040894.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 24, 2021 this sequence version replaced XM_029173678.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Betta splendens Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1978
                     /organism="Betta splendens"
                     /mol_type="mRNA"
                     /db_xref="taxon:158456"
                     /chromosome="14"
     gene            1..1978
                     /gene="LOC114869437"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 311 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:114869437"
     CDS             115..762
                     /gene="LOC114869437"
                     /codon_start=1
                     /product="claudin-3-like"
                     /protein_id="XP_029029511.1"
                     /db_xref="GeneID:114869437"
                     /translation="
MSMGMEIVGIALGCIGFIIAIVTCALPMWKVTAFIGANIVTAQTIWEGLWMNCVIQSTGQMQCKIYDSMLALNPDLQAARAMTVVAIILALLGVLISIVGAKCTNCIEDEASKAKVMIIAGIFFLLAGLLVLIPVSWTSSVIIRDFYNPLLTDAQRREIGASLYIGFGAAVLLIIGGAMLCSSCPPKEKQYKPPRMMYSAPRSASGAGYDKKDYV"
     misc_feature    121..654
                     /gene="LOC114869437"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:354884"
ORIGIN      
gtagcagcatctcttagcaactcacacaccctgttacaggtgctcacacctgaacgccggagcagaagagtcctttcctgcgatagacagacctcagaccagcagcctctcagcatgtccatgggtatggagattgtgggcatcgccctcggatgcattggatttatcatcgcaatagtgacgtgcgcgctgccaatgtggaaggtgaccgctttcattggggccaacatcgtcacggctcagaccatctgggagggtctgtggatgaactgtgtcatccagagcacgggccagatgcagtgcaagatctacgactccatgctggcgctgaatccggacctgcaggcggcccgagccatgaccgtcgtggccatcatcctggcgctgctcggcgtcctcatctccatcgtcggcgccaagtgcaccaactgcatcgaagacgaggcgtccaaggccaaggtgatgatcatcgccggcatattcttcctcctggccggcctcctcgtcctcatccccgtctcctggacctccagcgtcatcattcgggacttctacaaccccctcctgaccgacgcgcagcggagggagatcggcgcctcgctctacatcggcttcggcgccgccgtcctgctgatcatcggcggtgccatgctgtgcagcagctgcccgcccaaggagaagcagtacaagccccccaggatgatgtactcggctccacgcagcgccagcggagcaggttacgacaagaaagactatgtctgaggagcacttgatttggaaacttgtatatatgacgttgtgtgttgcatgtgggcgtcgctttcgctgttttccctctttgctaaagaaaaattgtttcatcccaacaaacacatcacggcaaaaagcctgtgcaaaacaaggctcggttcagatcaaactggagttataagatgggatgggctccagcagacgttactgttctttagtcagtcctgaagctaaactcatgtacaagtttagacttgttcaagatttagaacaggtgcagtaggttttccagcctgacctctgccagaggtgagattatgatttatacacaaaatgtcaagagagagttagaaattgtggcagtagatgaagctgtttttgtgcgattgctgagtttgagcaattttaggggaattcccattaaaagactccgagatgaaggcgacggtgttcgtagttgatctttctgctttgctttagttgacattaggcccagattccccaaggaaagatcagttatcagttatattatttttagttaaatgttctgaaattcaactgttctgttactggcgtacatgtcgtatactacacctactgtgacatcattcaaattaaaaaagcacctcatgtgtgaggctttgtcatacggctgtgggtcacatatcgcgtttcactgaaactatacttaaagccctgcgtgttccactgacaatgaccaggagaggccagctctcattttacagggctgtggttgctgtgtgcgagtgtgcgcgtgctttgcatgtaatatttgtttaggagagtttctgctgagactgaaactaaagatggctccatgatacggccacgtatgatgtcctcctccaacgtgtcagcgtgtggagaacaaaatgtctgaccataaaaacggccacgtttgatgtctttttatttcagttttatttcttttagccacgtttccatactttaattagatttatagatgtcgtactttcacttatcatgttgtgtgaaatgttgagctctgacctctgctcatctgaatgtcaaacaaagaggatattcgtttttaggtacaaggtatgtttgtgtcaatttaaaaaaacatgtcactgtttaaatatcatttattttaaagttttatgtcattttttgtaacaaactttgaatcatagtagtacttgaattataaatgtgttgaagatttcaataaaagtcattgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]