2025-07-02 10:24:28, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_029032793 300 bp mRNA linear PLN 03-DEC-2024 DEFINITION Candidozyma auris 60S ribosomal protein eL36 (CJI96_0003372), partial mRNA. ACCESSION XM_029032793 VERSION XM_029032793.1 DBLINK BioProject: PRJNA535510 BioSample: SAMN05379608 KEYWORDS RefSeq. SOURCE Candidozyma auris (Candida auris) ORGANISM Candidozyma auris Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Metschnikowiaceae; Candidozyma. REFERENCE 1 (bases 1 to 300) AUTHORS Munoz,J.F., Gade,L., Chow,N.A., Loparev,V.N., Juieng,P., Berkow,E.L., Farrer,R.A., Litvintseva,A.P. and Cuomo,C.A. TITLE Genomic insights into multidrug-resistance, mating and virulence in Candida auris and related emerging species JOURNAL Nat Commun 9 (1), 5346 (2018) PUBMED 30559369 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 300) AUTHORS Munoz,J.F., Welsh,R.M., Shea,T.S., Batra,D.B., Litvintseva,A.P., Gade,L.G. and Cuomo,C.A. TITLE Candida auris genome assembly and annotation JOURNAL Unpublished REFERENCE 3 (bases 1 to 300) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (02-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 4 (bases 1 to 300) AUTHORS Munoz,J.F., Welsh,R.M., Shea,T.S., Batra,D.B., Litvintseva,A.P., Gade,L.G. and Cuomo,C.A. TITLE Direct Submission JOURNAL Submitted (30-AUG-2019) Genome Sequencing and Analysis Program, Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA 02142, USA REFERENCE 5 (bases 1 to 300) AUTHORS Munoz,J.F., Gade,L.G., Chow,N.A., Litvintseva,A.P., Loparev,V.N. and Cuomo,C.A. TITLE Direct Submission JOURNAL Submitted (20-MAR-2018) Genome Sequencing and Analysis Program, Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA 02142, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_072814). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..300 /organism="Candidozyma auris" /mol_type="mRNA" /strain="B11220" /isolation_source="auditory canal" /host="Homo sapiens" /type_material="culture from holotype of Candida auris Satoh & Makimura, 2009" /db_xref="taxon:498019" /chromosome="3" /geo_loc_name="Japan" /collection_date="2009" gene <1..>300 /locus_tag="CJI96_0003372" /db_xref="GeneID:40025875" CDS 1..300 /locus_tag="CJI96_0003372" /codon_start=1 /transl_table=12 /product="60S ribosomal protein eL36" /protein_id="XP_028893108.1" /db_xref="GeneID:40025875" /translation="
MARSGIAVGLNKGHKVNAKEVAPKISQRKGALSQRTKFVRSIVSEVSGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMNQIIAESRRH"
misc_feature 7..294 /locus_tag="CJI96_0003372" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:460088" ORIGIN
atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacgctaaggaggttgctccaaagatctcccagagaaagggcgccctttcccagagaaccaagttcgtcagaagcattgtgtctgaggtttccggcttggctccatacgagagaagattgatcgagttgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctcagaaaggttgaggagatgaaccagatcattgctgagtccagaagacactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]