GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-23 23:26:32, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_028081208            2317 bp    mRNA    linear   PLN 11-FEB-2019
DEFINITION  PREDICTED: Vigna unguiculata protein NETWORKED 4B-like
            (LOC114191805), transcript variant X2, mRNA.
ACCESSION   XM_028081208
VERSION     XM_028081208.1
DBLINK      BioProject: PRJNA521068
KEYWORDS    RefSeq.
SOURCE      Vigna unguiculata (cowpea)
  ORGANISM  Vigna unguiculata
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; indigoferoid/millettioid clade;
            Phaseoleae; Vigna.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_040285.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Vigna unguiculata Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2317
                     /organism="Vigna unguiculata"
                     /mol_type="mRNA"
                     /cultivar="IT97K-499-35"
                     /db_xref="taxon:3917"
                     /chromosome="7"
                     /tissue_type="first leaves, hypocotyl, epicotyl and
                     cotyledon"
                     /dev_stage="seedling"
                     /country="USA: Riverside, CA"
     gene            1..2317
                     /gene="LOC114191805"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 ESTs, 8 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 38 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:114191805"
     CDS             134..2143
                     /gene="LOC114191805"
                     /codon_start=1
                     /product="protein NETWORKED 4B-like"
                     /protein_id="XP_027937009.1"
                     /db_xref="GeneID:114191805"
                     /translation="
MMKNQPSQWWWLESHSNTKLSPWLQSTLTELNEKTKAMLKLIEEDADSFAQRAEMYYKKRPQLVSLVEDFYRTHRSLAERYDQVAGIRQQKTGGSPFSPLKHHQPEKLMSFANDSYDSYSESCDVEESGESEIDDPEQEEEEDSKIDNCVELDGVQFVAANDVMEIERLGEENKDHKDLNKQKYNIYEAVMLWEEIEQLRKESRVQKDELNRKSIVFGELMILKEEIEQLSRENRAQKDELNQKAIICGEAMMLREEIEQLSKENRVLKDELSQKSIICDEVMMLREEIEQIRKENRAQKEELNQKDVICGEAIMSREEIEKLSKENRVLKDELNQKSILCGEVMMLREEIAQLRKENRAQKDELNQKDNSCSEIMMLREEIEQLGKENGGLKDELKKKDNICGEIMMLREEIEQLGKENGALRDELKKDNICDEIMMLREEIEQMGKENGALKNELNKKDNICGEIMMLREEIEQLGKENGALKVELNKKYIICGEIMMLREEIEQLRKENRGQKNELDQKGIKCEVTMFRGEIEEYTKENRVKNDELSPEDSVCGEEVMLRKEIERLGKDERAQSGTLCGEVKKLRQENSAQKDRLKQKDQEKIEVIRNLSLAIDMLKQENVKMRSFIAKESANKWKNPFGFKNFMGSLSEQLFNGITKNQPSLVAL"
     misc_feature    158..379
                     /gene="LOC114191805"
                     /note="KIP1-like protein; Region: KIP1; pfam07765"
                     /db_xref="CDD:429647"
     misc_feature    <716..1666
                     /gene="LOC114191805"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:274008"
ORIGIN      
gtgtataaaatggtcctactctaatatcttgctatgtgtgaactctaattctatcgcaggcggtggtggcaagcattgcattaattcatgctcttggtgttcttgataacataaacaactgaagagggctaaaatgatgaagaatcaaccgtcacagtggtggtggcttgagagccacagtaacactaaactatccccttggcttcaatccactctcacggagctaaatgagaagacaaaggcaatgttaaaactaattgaagaagatgcagattcctttgcccaacgtgctgagatgtattacaagaagagaccacagcttgtgagcctggttgaagatttctataggacacatcgatcattagctgagcggtatgatcaagtcgctggaattcgtcagcagaagactggaggatcccccttttctccgctcaagcatcatcaaccagagaagttgatgagttttgcgaatgacagttatgatagctattctgagagttgtgatgtggaggagtctggggaatctgaaattgatgatcctgagcaagaagaggaagaggattccaaaatcgataactgtgtagaactggacggagttcagtttgtggctgcaaatgatgtgatggaaattgagagacttggtgaagagaacaaggatcataaggatctgaacaagcagaaatataacatttacgaagcagtgatgttatgggaagaaatagagcaactcagaaaagagagcagggttcaaaaggatgaactcaaccggaaaagcatcgtttttggtgaattaatgattctgaaggaagaaatagagcaactaagcagagaaaacagagcgcagaaggatgaactcaaccagaaagctatcatttgtggtgaagctatgatgttgagggaagaaatagaacaactcagtaaagagaatagagttctgaaggatgaactaagccagaaaagtatcatttgtgatgaagtaatgatgttgagggaagaaatagagcaaatcagaaaagagaatagagcgcagaaggaagaactcaaccagaaagatgtcatttgtggtgaagcaatcatgtcgagggaagaaatagaaaaactcagtaaagagaatagagtcctgaaggatgaactgaaccagaaaagtatcctttgtggtgaagtaatgatgttgagggaagaaatagcgcaactcagaaaagagaatagagcgcagaaggatgaactcaaccagaaagataacagttgcagtgaaataatgatgttgagggaagaaatagaacaattgggaaaagagaatggagggctgaaggatgaactaaagaagaaagataacatttgcggtgaaataatgatgttgagggaagaaatagaacaattggggaaagagaatggagcgctgagggatgaactcaagaaagataacatttgcgatgaaattatgatgttgagggaagaaatagaacaaatgggaaaagagaacggagcgctgaagaatgaactcaacaagaaagataacatttgcggtgaaataatgatgttgagggaagaaatagaacaattgggaaaagagaatggagcgctgaaggttgaactcaacaagaaatatatcatttgtggagaaataatgatgttgagggaagaaatagaacaactcaggaaagagaatagagggcagaagaatgaactcgaccagaaaggtatcaagtgtgaagtaacgatgtttaggggagaaattgaagaatacacaaaagagaatagagtgaagaatgatgaactcagtccagaagacagcgtttgtggtgaagaagtgatgttaagaaaagaaatcgaacgacttggaaaagatgaaagagcacaaagtggtaccctttgtggtgaagtaaagaagttaaggcaagagaatagcgcgcagaaggaccgtcttaagcaaaaagaccaagagaaaatagaggtgataagaaacctgagtttagctatagatatgctgaagcaggagaacgtaaagatgagaagcttcattgctaaggaatctgccaacaaatggaagaatccatttgggtttaagaatttcatgggatcattatcagagcagttgtttaatggaattacgaagaatcaacctagtcttgtagctctctagataaggttcacagagtaaatagctaagttttgtagaacataatattaaaagaggcttgtgtacatgttatggggacctgctcaagtaacctgcagatcttgtatacagtttagtatattcctaactaatccaagaccgagtatctagaggatttcctctacacttgtttttata
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]