GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-15 06:01:22, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_028012414            1998 bp    mRNA    linear   VRT 11-FEB-2019
DEFINITION  PREDICTED: Xiphophorus couchianus trichohyalin-like (LOC114141699),
            transcript variant X3, mRNA.
ACCESSION   XM_028012414
VERSION     XM_028012414.1
DBLINK      BioProject: PRJNA516883
KEYWORDS    RefSeq.
SOURCE      Xiphophorus couchianus (Monterrey platyfish)
  ORGANISM  Xiphophorus couchianus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Ovalentaria; Atherinomorphae; Cyprinodontiformes;
            Poeciliidae; Poeciliinae; Xiphophorus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_040230.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xiphophorus couchianus Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1998
                     /organism="Xiphophorus couchianus"
                     /mol_type="mRNA"
                     /isolation_source="77th inbred generation (sibling line
                     bred)"
                     /specimen_voucher="Xc77(B)"
                     /db_xref="taxon:32473"
                     /chromosome="3"
                     /sex="female"
                     /country="Mexico: Nuevo Leon, Huasteca Canyon"
                     /collection_date="1961"
     gene            1..1998
                     /gene="LOC114141699"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 1 sample with support for all annotated introns"
                     /db_xref="GeneID:114141699"
     CDS             63..1979
                     /gene="LOC114141699"
                     /codon_start=1
                     /product="trichohyalin-like isoform X3"
                     /protein_id="XP_027868215.1"
                     /db_xref="GeneID:114141699"
                     /translation="
MENNRDEDSSTVNVNNAKRPLNTEEEMKSSALRLSSLLLVCFGLLCAILTAKFVYMSMMTANQMENIKTLATDKKRLIEERKMMKNQIEQVIRDRLLSLLRERLTRERLTQVSEELSNKIEELNRQTEELKKERDELSKEKEEVNKKKEEVNQDREELISNTQGLKKERDELNKEQVKQSKEKEKLKEEEEELSKEKKELSNEKEELSKRKEELKEKDERAGLIKEKDKLSKEKKELNTEKDKLKKKNDELSKEKEEIRKEKDELNKEKYKLSKDKEELSKEKDRLNKQKGDLNKMKAELIKKKEGLSEKTKELNKEINKLNKEKDELSKKTEELIKKKEQLNKEEDELKKEEDKLSKKKEELIKKIEELSKKIMELNKEKAGLSKEKDELSKQKAKLDKEKDELSKDKKKLSNEKDKLDKEKDELSKDKKKLSNEKDGLNKEEGDLNKMKVEQSQKKGELSKEKEELNKMAKELNKEKDDLSKKTAELTKKTEELNKLKVNMDKDLNENKLELNKEKEELNKLKVNLNKEKDELNKNKGKLNKEKEELNKKKVDLNKEKEELNKKKVDLNKEKEELNRQKAELSTKKAELSKKTEELIKKSKDLHKEKEELNKMKDMLSKEKEKLKKEKEKLRQRER"
     misc_feature    279..1919
                     /gene="LOC114141699"
                     /note="helix-rich Mycoplasma protein; Region:
                     Mplasa_alph_rch; TIGR04523"
                     /db_xref="CDD:275316"
ORIGIN      
aagaagaagaagtcagcatcgcagcaaagaaattactgaagactgatatctgttttcacaggatggagaacaacagggatgaagattcttctacagtcaatgtcaacaatgccaaacgtcctcttaatactgaagaagaaatgaaatcatcagcactccggctctcttctctgttgttggtgtgttttgggttgctttgtgccatactgactgcaaaatttgtctacatgagtatgatgacggccaatcagatggaaaatatcaaaacccttgcaacagacaaaaagcgactgattgaggaacgaaagatgatgaaaaaccaaattgagcaggtgatccgagacagactcctgagcctgttaagagagaggcttactcgagagaggcttactcaagtcagcgaggagctgagcaataagatagaggagctgaaccgacagacagaggagctgaagaaagagagagacgagctgagcaaagagaaagaggaggtgaacaaaaagaaggaggaggtgaaccaagacagagaggagctgattagtaacacacaggggctgaagaaagagagagatgagctgaataaagagcaagtgaaacagagcaaagagaaagagaagctaaaagaagaggaagaagagctaagcaaagagaaaaaagagctgagcaatgagaaagaggagctgagcaaaaggaaagaggagctgaaagaaaaagatgagagagcaggacttattaaagagaaagacaagctgagcaaagagaagaaggagctgaacactgagaaagacaaactgaagaaaaagaatgacgagctgagcaaagagaaagaggaaataagaaaagagaaagatgaactgaacaaagaaaaatacaagctgagcaaagacaaagaagagctgagcaaagagaaagacagactgaacaaacagaaaggagacctgaacaaaatgaaagcggagctgatcaaaaagaaagaggggctcagcgagaaaacaaaggagctgaacaaagaaataaataagctgaacaaagagaaagatgagctgagcaaaaagacagaggagctgatcaaaaagaaagagcagctaaacaaagaggaagatgagctgaaaaaagaagaagataagttgagcaaaaagaaagaagagttgatcaaaaagatagaggagctcagcaaaaaaataatggagctgaacaaagagaaagcagggctgagcaaagagaaagatgagctgagcaaacagaaagcaaaactggacaaagagaaagacgagctgagcaaagacaaaaagaagctgagcaacgagaaagacaaactggacaaagagaaagacgagctgagcaaagacaaaaagaagctgagcaatgagaaagatggactgaacaaagaggaaggcgacctaaacaaaatgaaagtggagcagagccaaaaaaagggggagctgagcaaagagaaagaggagctgaacaaaatggcaaaggagctgaacaaagagaaagatgacctgagcaaaaagacagcagagctgaccaagaaaacagaggagctgaacaaattgaaagtgaatatggacaaagacctgaacgaaaataaattagagctgaacaaggagaaagaggagctgaacaaattgaaagtgaacttgaacaaagagaaagatgagctgaacaaaaataaaggaaagttgaacaaagagaaagaggagctgaacaaaaagaaagtggacttgaacaaagagaaagaggagctgaacaaaaagaaagtggacttgaacaaagagaaagaggagctgaacaggcagaaagcagagctgagcacaaagaaagcagagctgagcaaaaagacagaggagctgatcaaaaagtcaaaggatctgcacaaggagaaagaggagctgaacaaaatgaaagatatgctgagcaaagagaaagagaagctgaaaaaagagaaagagaagctgagacaaagagaaagataagctgagcaaagatagaaag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]