2024-04-27 06:06:26, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_027201049 345 bp mRNA linear INV 30-NOV-2018 DEFINITION PREDICTED: Pocillopora damicornis ubiquitin-like protein ATG12 (LOC113683766), mRNA. ACCESSION XM_027201049 VERSION XM_027201049.1 DBLINK BioProject: PRJNA506040 KEYWORDS RefSeq; includes ab initio. SOURCE Pocillopora damicornis ORGANISM Pocillopora damicornis Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Scleractinia; Astrocoeniina; Pocilloporidae; Pocillopora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_020847271.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Pocillopora damicornis Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 17% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..345 /organism="Pocillopora damicornis" /mol_type="mRNA" /isolate="RSMAS" /isolation_source="eastern tropical pacific" /db_xref="taxon:46731" /chromosome="Unknown" /tissue_type="whole animal" /country="Panama:Saboga Island" /collection_date="Mar-2005" /collected_by="PW Glynn" gene 1..345 /gene="LOC113683766" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:113683766" CDS 1..345 /gene="LOC113683766" /codon_start=1 /product="ubiquitin-like protein ATG12" /protein_id="XP_027056850.1" /db_xref="GeneID:113683766" /translation="
MADGGGGAVQEEIGRDMVEGQRKMSEPAQPANNHQAQKSEASKKSLKKKVEVLLKAAGDASIMVKKKWVVDGSKQVSYIIEFIRKYIKCEQQDSLCFGADGKLVLHYCKTQAWG"
misc_feature 145..339 /gene="LOC113683766" /note="ubiquitin-like (Ubl) domain found in autophagy-related protein 12 (ATG12); Region: Ubl_ATG12; cd01612" /db_xref="CDD:340454" misc_feature order(145..147,151..156,160..162,187..189,193..195, 199..213,220..222,232..237,244..249,253..258,262..264) /gene="LOC113683766" /note="Atg12; Atg5-Atg16-Atg3 interaction site [polypeptide binding]; other site" /db_xref="CDD:340454" misc_feature order(163..165,190..192) /gene="LOC113683766" /note="key conserved lysines; other site" /db_xref="CDD:340454" ORIGIN
atggcggatggtggaggaggagccgtgcaagaagagattggcagagatatggtcgaagggcaacgaaaaatgtctgaaccagcacaacctgcaaacaatcatcaagcacagaaaagcgaagcgtcaaagaaatcattgaaaaagaaagtggaagtgttgcttaaagccgctggagatgcctctattatggtgaaaaagaaatgggtagtggatggatcaaaacaagtgtcatatattatagaatttattaggaagtacatcaaatgcgagcaacaagactcattgtgctttggagctgatggaaagttagttcttcattactgtaagacgcaagcatggggataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]