GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-11-18 18:42:51, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_027201049             345 bp    mRNA    linear   INV 30-NOV-2018
DEFINITION  PREDICTED: Pocillopora damicornis ubiquitin-like protein ATG12
            (LOC113683766), mRNA.
ACCESSION   XM_027201049
VERSION     XM_027201049.1
DBLINK      BioProject: PRJNA506040
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Pocillopora damicornis (cauliflower coral)
  ORGANISM  Pocillopora damicornis
            Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Scleractinia;
            Astrocoeniina; Pocilloporidae; Pocillopora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_020847271.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Pocillopora damicornis Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 17% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..345
                     /organism="Pocillopora damicornis"
                     /mol_type="mRNA"
                     /isolate="RSMAS"
                     /isolation_source="eastern tropical pacific"
                     /db_xref="taxon:46731"
                     /chromosome="Unknown"
                     /tissue_type="whole animal"
                     /geo_loc_name="Panama:Saboga Island"
                     /collection_date="Mar-2005"
                     /collected_by="PW Glynn"
     gene            1..345
                     /gene="LOC113683766"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:113683766"
     CDS             1..345
                     /gene="LOC113683766"
                     /codon_start=1
                     /product="ubiquitin-like protein ATG12"
                     /protein_id="XP_027056850.1"
                     /db_xref="GeneID:113683766"
                     /translation="
MADGGGGAVQEEIGRDMVEGQRKMSEPAQPANNHQAQKSEASKKSLKKKVEVLLKAAGDASIMVKKKWVVDGSKQVSYIIEFIRKYIKCEQQDSLCFGADGKLVLHYCKTQAWG"
     misc_feature    145..339
                     /gene="LOC113683766"
                     /note="ubiquitin-like (Ubl) domain found in
                     autophagy-related protein 12 (ATG12); Region: Ubl_ATG12;
                     cd01612"
                     /db_xref="CDD:340454"
     misc_feature    order(145..147,151..156,160..162,187..189,193..195,
                     199..213,220..222,232..237,244..249,253..258,262..264)
                     /gene="LOC113683766"
                     /note="Atg12;
                     Atg5-Atg16-Atg3 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:340454"
     misc_feature    order(163..165,190..192)
                     /gene="LOC113683766"
                     /note="key conserved lysines; other site"
                     /db_xref="CDD:340454"
ORIGIN      
atggcggatggtggaggaggagccgtgcaagaagagattggcagagatatggtcgaagggcaacgaaaaatgtctgaaccagcacaacctgcaaacaatcatcaagcacagaaaagcgaagcgtcaaagaaatcattgaaaaagaaagtggaagtgttgcttaaagccgctggagatgcctctattatggtgaaaaagaaatgggtagtggatggatcaaaacaagtgtcatatattatagaatttattaggaagtacatcaaatgcgagcaacaagactcattgtgctttggagctgatggaaagttagttcttcattactgtaagacgcaagcatggggataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]