GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-24 00:08:06, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_026588029            1054 bp    mRNA    linear   PLN 02-OCT-2018
DEFINITION  PREDICTED: Papaver somniferum uncharacterized LOC113343944
            (LOC113343944), mRNA.
ACCESSION   XM_026588029
VERSION     XM_026588029.1
DBLINK      BioProject: PRJNA492326
KEYWORDS    RefSeq.
SOURCE      Papaver somniferum (opium poppy)
  ORGANISM  Papaver somniferum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae;
            Papaveroideae; Papaver.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_020649860.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Papaver somniferum Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1054
                     /organism="Papaver somniferum"
                     /mol_type="mRNA"
                     /cultivar="HN1"
                     /db_xref="taxon:3469"
                     /chromosome="Unknown"
                     /tissue_type="leaves"
                     /dev_stage="seedling"
                     /country="Australia"
     gene            1..1054
                     /gene="LOC113343944"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments"
                     /db_xref="GeneID:113343944"
     CDS             16..627
                     /gene="LOC113343944"
                     /codon_start=1
                     /product="uncharacterized protein LOC113343944"
                     /protein_id="XP_026443814.1"
                     /db_xref="GeneID:113343944"
                     /translation="
MQRKDKISVLQARNDELELKLHHTQVEKDELELKLHHARVEKDELELKLHHAQVEKDELVHHAQVEKDKLLFQIELLRKGKSWVEIDVVHGDETGAFQGDETDDVQGDEIDDVQGDEIDDDSFRSDEIDDEIDDDRGGDETGAVHGDETGAVQGDETGDVQGAEIDDDSLRSSKRQKRSPLVEKIITKRGRGRPPKPKKRSSS"
ORIGIN      
aaccacacagctcagatgcagagaaaggacaaaatttcggtcctccaagcaagaaatgatgaattagagctcaagctccatcatactcaggttgaaaaagatgaattagagctcaagctccatcatgctcgggttgaaaaagatgaattagagctcaagctccaccatgctcaggttgaaaaagatgaattagtccatcatgctcaggttgaaaaagataagctgcttttccaaattgagttgttaagaaaaggaaagtcgtgggttgagattgatgttgttcatggtgatgagactggtgcttttcagggtgatgagactgatgatgttcagggcgatgagattgatgatgttcagggcgatgagattgatgatgatagcttcagaagtgatgagattgatgatgagattgatgatgatagaggtggtgatgagactggtgctgttcatggtgatgagactggtgctgttcagggtgatgagactggtgatgttcagggtgctgagattgatgatgatagcttgagaagttccaagaggcagaagagatcccctcttgttgagaagataataactaaaagaggtagaggtcgtcctcctaagcctaagaagaggtcgtcctcctaagtctaagaaggaaaaacctaaaaaacctgtaggtcgtccacgtaagaggcatgttggaagacctaagaaagtccgatgaccaaataattaaactgctttcgaattaaagcatcatacttaatgtgatcatactaagaaagtctgatgattttggttgtaagattatgtttttgtgctcaagaaatgaaatggggtattgcttacaatggccataatggtcaggtaaagtgacttataatggtcatgaaatggatgagtttgttccttagagaacttctggaggggattctgcgacttaaaattttcacttaattttacacaccatttatagatcatagatgagaagatatctaacggtccttattctgggtcaaatctaattattataatgaattagcttggcttaaagccgcgccagttatctcca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]