2024-04-19 12:20:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_026098727 1122 bp mRNA linear VRT 09-AUG-2018 DEFINITION PREDICTED: Dromaius novaehollandiae vimentin (VIM), mRNA. ACCESSION XM_026098727 VERSION XM_026098727.1 DBLINK BioProject: PRJNA484763 KEYWORDS RefSeq. SOURCE Dromaius novaehollandiae (emu) ORGANISM Dromaius novaehollandiae Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Palaeognathae; Casuariiformes; Dromaiidae; Dromaius. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_020452426.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Dromaius novaehollandiae Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1122 /organism="Dromaius novaehollandiae" /mol_type="mRNA" /isolate="6597" /specimen_voucher="MCZ:Cryo:6597" /db_xref="taxon:8790" /chromosome="Unknown" /sex="male" /tissue_type="muscle" /dev_stage="adult" /collected_by="Dan Janes" gene 1..1122 /gene="VIM" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 162 ESTs, 49 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 37 samples with support for all annotated introns" /db_xref="GeneID:112982377" CDS 169..798 /gene="VIM" /codon_start=1 /product="vimentin" /protein_id="XP_025954512.1" /db_xref="GeneID:112982377" /translation="
MDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQEANEYRRQIQSLTCEVDALKGSNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRINMPIPTFASLNLRETNIESQPMVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE"
misc_feature <169..627 /gene="VIM" /note="Intermediate filament protein; Region: Filament; pfam00038" /db_xref="CDD:425436" ORIGIN
atcagccttatctctgattaggatgttgacaatgcctccctggcacgcctcgatcttgagcgcaaagttgagtccctgcaagaagagattgtgttcttgaagaagcttcatgatgaggaaatccgagaactgcaggcccaactccaggaacagcacatccaaattgatatggatgtttctaagcctgatcttactgctgccctgcgtgacgttcgccaacagtatgaaagcgttgctgctaagaatcttcaggaagctgaagagtggtacaagtccaaatttgcagatctctctgaagctgctaataggaacaacgatgccctgcgccaggccaaacaagaagctaatgaatatcgcagacagattcagtctctcacctgcgaagttgatgctcttaaaggaagcaatgaatccctggagcgccaaatgcgtgaaatggaggagaattttgctgttgaagctgctaactaccaagacactattggccgtctgcaggatgagattcaaaacatgaaggaagaaatggctcgccatcttcgcgagtaccaggacctgctgaatgtaaagatggctcttgatattgagattgccacctacagaaaactgctggagggagaagagagcaggattaacatgcctattccaacctttgcttctctgaacctgagagaaaccaacattgagtctcagccaatggttgacactcactcaaagaggacactcctaattaagaccgtggaaactagagatggacaggttattaatgaaacttcccagcatcatgatgacttggagtaaaactgaagtgatgatgaataattaatgtaggagaacttcttaccagcaagatttaaaaagtccatgtcttaaaggaagaaaaagctttcaagtgcctttctgcagtttttccatgagcgcaagattattatgctaggaaataggtcttagatcttgcaaactgactctccctgaaggattagagtttacaacggagtctagtttacaaatagcaatatcttgtgctgcaatactgtttttaagtatctgaatccaataaaactgctttttccagcacagtatgagcaacctgtcgctacttcaaataaatctttggaaaatggc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]