GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-29 11:10:12, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_026087134            1262 bp    mRNA    linear   VRT 08-AUG-2018
DEFINITION  PREDICTED: Apteryx rowi vimentin (VIM), mRNA.
ACCESSION   XM_026087134
VERSION     XM_026087134.1
DBLINK      BioProject: PRJNA484763
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Apteryx rowi (Okarito brown kiwi)
  ORGANISM  Apteryx rowi
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Palaeognathae; Apterygiformes; Apterygidae;
            Apteryx.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_020450988.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Apteryx rowi Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 13% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1262
                     /organism="Apteryx rowi"
                     /mol_type="mRNA"
                     /isolate="R43461"
                     /specimen_voucher="ROM:ORN:R43461"
                     /db_xref="taxon:308060"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="blood"
                     /dev_stage="adult"
                     /country="New Zealand: Okarito, Westland"
                     /collection_date="16-Jul-1993"
                     /collected_by="Royal Ontario Museum"
     gene            1..1262
                     /gene="VIM"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 mRNA, 162 ESTs, 47 Proteins, and
                     89% coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:112976178"
     CDS             1..939
                     /gene="VIM"
                     /codon_start=1
                     /product="vimentin"
                     /protein_id="XP_025942919.1"
                     /db_xref="GeneID:112976178"
                     /translation="
MLVGEWDKDSEEDWKKMVQDDQGGYDEQGCCQLRRYTQSLLVFWEQKFEKEEFKDVDNASLARLDLERKVESLQEEIVFLKKLHDEEIRELQAQLQEQHIQIDMDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQEANEYRRQIQSLTCEVDALKGSNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRINMPIPTFASLNLRETNIESQPMVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE"
     misc_feature    <160..768
                     /gene="VIM"
                     /note="Intermediate filament protein; Region: Filament;
                     pfam00038"
                     /db_xref="CDD:425436"
ORIGIN      
atgctggttggagaatgggacaaagacagtgaggaagactggaagaagatggttcaagatgatcaaggtggctatgatgagcaaggttgttgccagctaagaagatacactcagtctctgttagtattctgggaacagaagtttgaaaaagaagaattcaaggatgttgacaatgcctctctggcacgtcttgatctggagcgcaaagttgagtccctgcaagaagagattgtgttcttgaagaagcttcatgatgaggaaatccgagaattgcaggcccaactccaggaacagcacatccaaattgatatggatgtttctaagcctgatcttactgctgccctgcgtgatgttcgccaacagtatgaaagcgttgctgctaagaatcttcaggaagctgaagaatggtacaagtccaaatttgcagatctctctgaagctgctaataggaacaacgatgccctgcgccaggccaaacaagaagctaatgaataccgcagacagattcaatctctcacctgcgaagttgatgctcttaaaggaagcaatgaatccctggagcgccaaatgcgtgaaatggaggagaattttgctgttgaagctgctaactaccaagacactattggccgtctgcaggatgagattcaaaacatgaaggaagaaatggctcgccatcttcgtgagtaccaggacctgctgaatgtaaagatggctcttgatattgagattgccacctacagaaaactgctggagggagaagagagcaggattaacatgcctattccaacctttgcttctctgaacctgagagaaaccaacattgagtctcagccaatggttgacactcactcaaagaggacactcctaattaagactgttgaaactagagatggacaggttattaatgaaacttcccagcatcatgatgacttggagtaaaactgaagtgatgatgaataattaatgcaggagatcttcttaccagcaagatttaaaaagtccatgtcttaaaggaagaaacagctttcaagtgcctttctgcagttttcccatgagcgcaagattattctgctaagaaataggtcttagatcttgcaaactgactctccctgaaggattagtttacagcagagtctagtttacaaatagcaatatcttgtgctgcaatactgttttttaagtatctgaatctaataaaaatgctttttccagcacagtatgagcaacctgtcgctacttcaaataaatctttggaaaatggc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]