GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-06-18 02:30:11, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_025497511             618 bp    mRNA    linear   PLN 10-FEB-2020
DEFINITION  Meira miltonrushii Isochorismatase hydrolase (FA14DRAFT_152158),
            partial mRNA.
ACCESSION   XM_025497511
VERSION     XM_025497511.1
DBLINK      BioProject: PRJNA479903
            BioSample: SAMN02787052
KEYWORDS    RefSeq.
SOURCE      Meira miltonrushii
  ORGANISM  Meira miltonrushii
            Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina;
            Exobasidiomycetes; Exobasidiales; Brachybasidiaceae; Meira.
REFERENCE   1  (bases 1 to 618)
  AUTHORS   Kijpornyongpan,T., Mondo,S.J., Barry,K., Sandor,L., Lee,J.,
            Lipzen,A., Pangilinan,J., LaButti,K., Hainaut,M., Henrissat,B.,
            Grigoriev,I.V., Spatafora,J.W. and Aime,M.C.
  TITLE     Broad genomic sampling reveals a smut pathogenic ancestry of the
            fungal clade Ustilaginomycotina
  JOURNAL   Mol. Biol. Evol. (2018) In press
   PUBMED   29771364
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 618)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (10-FEB-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 618)
  AUTHORS   Mondo,S.J., Kijpornyongpan,T., Barry,K., Sandor,L., Lee,J.,
            Lipzen,A., Pangilinan,J., Labutti,K., Hainaut,M., Henrissat,B.,
            Grigoriev,I.V., Spatafora,J.W., Aime,M.C., Nordberg,H.P.,
            Cantor,M.N. and Hua,S.X.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2016) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_020289943).
            
            ##Metadata-START##
            Organism Display Name :: Meira miltonrushii MCA 3882
            GOLD Stamp ID         :: Gp0091365
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..618
                     /organism="Meira miltonrushii"
                     /mol_type="mRNA"
                     /strain="MCA 3882"
                     /type_material="holotype of Meira miltonrushii"
                     /db_xref="taxon:1280837"
                     /chromosome="Unknown"
     gene            <1..>618
                     /locus_tag="FA14DRAFT_152158"
                     /db_xref="GeneID:37019292"
     CDS             1..618
                     /locus_tag="FA14DRAFT_152158"
                     /codon_start=1
                     /product="Isochorismatase hydrolase"
                     /protein_id="XP_025357034.1"
                     /db_xref="GeneID:37019292"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="JGIDB:Meimi1_152158"
                     /translation="
MATRSIPRLEQSSSALFLCDIQERFTKAIHEFDNMAKASSKLLRGAQILEIPVFTTEQNSKALGSTVDVLKKDIPENSTIVDKTRFSMVLDDGTTDKWLRDHKVQNVMIVGIESHVCVLQTTLDLLKKGFNVFIIRDAISSCNKQEVPLAIERMRLAGATITTSESALFELMLDSKHPHFKAISGLIKTEKDSTKAALEALTSRI"
     misc_feature    43..516
                     /locus_tag="FA14DRAFT_152158"
                     /note="Cysteine hydrolases; This family contains
                     amidohydrolases, like CSHase (N-carbamoylsarcosine
                     amidohydrolase), involved in creatine metabolism and
                     nicotinamidase, converting nicotinamide to nicotinic acid
                     and ammonia in the pyridine nucleotide cycle. It...;
                     Region: cysteine_hydrolases; cl00220"
                     /db_xref="CDD:444760"
     misc_feature    order(58..60,247..249,349..351)
                     /locus_tag="FA14DRAFT_152158"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238245"
     misc_feature    334..339
                     /locus_tag="FA14DRAFT_152158"
                     /note="conserved cis-peptide bond [active]"
                     /db_xref="CDD:238245"
ORIGIN      
atggcaaccagatcaattcctagacttgaacaatcttcaagcgctttgtttttgtgtgatattcaagaacgttttacaaaagcaattcatgaattcgataatatggcaaaagcatcttcaaaacttttgaggggcgctcaaatcttggagatcccagttttcacaactgaacaaaactcgaaagctcttggatcgacggtagacgttctcaagaaagatatcccagaaaattccacaatcgttgacaagacccgattcagtatggtattggacgatggaacaacagataaatggctacgcgatcacaaagttcaaaatgtgatgattgtcggaattgagagtcacgtatgcgtcttacaaacgacattggacttgctcaagaaaggcttcaacgttttcatcattcgtgatgcaatctcttcttgtaataaacaagaagttccacttgccatcgaaagaatgcgtttggctggcgctacaatcacaacatccgaaagcgctctgtttgaactgatgctagattcaaaacatccccatttcaaagctatcagtgggctaatcaagacggaaaaggacagtacaaaagccgctcttgaagcactcacatcacgtatttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]