GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-15 06:02:19, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_025313793             289 bp    mRNA    linear   PLN 27-JUN-2018
DEFINITION  Rhizophagus irregularis DAOM 181602=DAOM 197198 hypothetical
            protein (GLOIN_2v1524752), mRNA.
ACCESSION   XM_025313793
VERSION     XM_025313793.1
DBLINK      BioProject: PRJNA471752
            BioSample: SAMN02744054
KEYWORDS    RefSeq.
SOURCE      Rhizophagus irregularis DAOM 181602=DAOM 197198
  ORGANISM  Rhizophagus irregularis DAOM 181602=DAOM 197198
            Eukaryota; Fungi; Fungi incertae sedis; Mucoromycota;
            Glomeromycotina; Glomeromycetes; Glomerales; Glomeraceae;
            Rhizophagus.
REFERENCE   1  (bases 1 to 289)
  AUTHORS   Chen,E.C.H., Morin,E., Beaudet,D., Noel,J., Yildirir,G.,
            Ndikumana,S., Charron,P., St-Onge,C., Giorgi,J., Kruger,M.,
            Marton,T., Ropars,J., Grigoriev,I.V., Hainaut,M., Henrissat,B.,
            Roux,C., Martin,F. and Corradi,N.
  TITLE     High intraspecific genome diversity in the model arbuscular
            mycorrhizal symbiont Rhizophagus irregularis
  JOURNAL   New Phytol. (2018) In press
   PUBMED   29355972
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 289)
  AUTHORS   Tisserant,E., Malbreil,M., Kuo,A., Kohler,A., Symeonidi,A.,
            Balestrini,R., Charron,P., Duensing,N., Frei Dit Frey,N.,
            Gianinazzi-Pearson,V., Gilbert,L.B., Handa,Y., Herr,J.R., Hijri,M.,
            Koul,R., Kawaguchi,M., Krajinski,F., Lammers,P.J., Masclaux,F.G.,
            Murat,C., Morin,E., Ndikumana,S., Pagni,M., Petitpierre,D.,
            Requena,N., Rosikiewicz,P., Riley,R., Saito,K., San Clemente,H.,
            Shapiro,H., van Tuinen,D., Becard,G., Bonfante,P., Paszkowski,U.,
            Shachar-Hill,Y.Y., Tuskan,G.A., Young,P.W., Sanders,I.R.,
            Henrissat,B., Rensing,S.A., Grigoriev,I.V., Corradi,N., Roux,C. and
            Martin,F.
  TITLE     Genome of an arbuscular mycorrhizal fungus provides insight into
            the oldest plant symbiosis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 110 (50), 20117-20122 (2013)
   PUBMED   24277808
REFERENCE   3  (bases 1 to 289)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JUN-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 289)
  AUTHORS   Morin,E., Chen,E.C.H., Charron,P., Grigoriev,I.V., Roux,C.,
            Martin,F.M. and Corradi,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JAN-2018) UMR 1136 IAM, INRA, route d'Amance,
            Champenoux 54280, France
REFERENCE   5  (bases 1 to 289)
  AUTHORS   Kuo,A., Tisserant,E., Malbreil,M., Kohler,A., Symeonidi,A.,
            Balestrini,R., Charron,P., Duensing,N., Frei-dit-Frey,N.,
            Gianinazzi-Pearson,V., Gilbert,B., Handa,Y., Hijri,M., Kaul,R.,
            Kawaguchi,M., Krajinski,F., Lammers,P., Lapierre,D., Masclaux,F.G.,
            Murat,C., Morin,E., Ndikumana,S., Pagni,M., Petitpierre,D.,
            Requena,N., Rosikiewicz,P., Riley,R., Saito,K., San Clemente,H.,
            Shapiro,H., van Tuinen,D., Becard,G., Bonfante,P., Paszkowski,U.,
            Shachar-Hill,Y., Young,J.P., Sanders,I.R., Henrissat,B.,
            Rensing,S.A., Grigoriev,I.V., Corradi,N., Roux,C. and Martin,F.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUL-2013) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_020269277).
FEATURES             Location/Qualifiers
     source          1..289
                     /organism="Rhizophagus irregularis DAOM 181602=DAOM
                     197198"
                     /mol_type="mRNA"
                     /strain="DAOM 197198"
                     /db_xref="taxon:747089"
                     /chromosome="Unknown"
                     /note="sequenced strain was DAOM 197198; coidentical
                     strain: DAOM 197198 = DAOM 181602"
     gene            1..289
                     /locus_tag="GLOIN_2v1524752"
                     /db_xref="GeneID:36864093"
     CDS             43..249
                     /locus_tag="GLOIN_2v1524752"
                     /note="expressed protein"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_025186518.1"
                     /db_xref="GeneID:36864093"
                     /db_xref="JGIDB:Rhiir2_1_1524752"
                     /translation="
MKIQKPKKKIKNKIKQTKDELNDKLEHTKDELYDKLEQTKDELKQELKEVKTLLTNLINNLNINSNNI"
ORIGIN      
tttaattttcctccattcatcagtaagaaattaaaagaattaatgaaaattcaaaaacctaaaaagaaaattaaaaacaaaattaaacaaacaaaagatgaacttaatgataaacttgaacatacaaaagatgaactttatgataaacttgaacaaacaaaagatgaacttaaacaagaacttaaagaagttaaaacattgttaactaatctcattaataatttaaatattaatagtaataatatttaggatattaaatattttatataagctgattttttttatattc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]