GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-23 03:27:16, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       XM_024653672            1398 bp    mRNA    linear   INV 10-APR-2018
DEFINITION  Strongyloides ratti Homeobox domain and Homeobox KN domain and
            Homeodomain-like-containing protein (SRAE_2000258700), partial
            mRNA.
ACCESSION   XM_024653672
VERSION     XM_024653672.1
DBLINK      BioProject: PRJNA304930
            BioSample: SAMEA1682816
KEYWORDS    RefSeq.
SOURCE      Strongyloides ratti
  ORGANISM  Strongyloides ratti
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Panagrolaimoidea; Strongyloididae; Strongyloides.
REFERENCE   1  (bases 1 to 1398)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2
  AUTHORS   Aslett,A.Martin.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-SEP-2014) WTSI, Pathogen Informatics, Wellcome Trust
            Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge
            Cambridgeshire. CB10 1SA, United Kingdom
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_037308).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1398
                     /organism="Strongyloides ratti"
                     /mol_type="mRNA"
                     /strain="ED321 Heterogonic"
                     /db_xref="taxon:34506"
                     /chromosome="2"
     gene            <1..>1398
                     /locus_tag="SRAE_2000258700"
                     /db_xref="GeneID:36380291"
     CDS             1..1398
                     /locus_tag="SRAE_2000258700"
                     /codon_start=1
                     /product="Homeobox domain and Homeobox KN domain and
                     Homeodomain-like-containing protein"
                     /protein_id="XP_024507126.1"
                     /db_xref="GeneID:36380291"
                     /db_xref="GOA:A0A090LDP9"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR008422"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:A0A090LDP9"
                     /translation="
MNNDAIRFLSASGPLLGPGFSGFPSTNMINPGAAAVAAQAVADANNFRAAFAANQAQTLQFPGLYPQLTPDMKPDMLATAVAGSGMPPYMFDPSIGFHPYGGGFDGGRRKNATRETTAPLKQWLNEHRKNPYPTKAEKIMLALLTKMSLTQVSTWFANARRRLKKENKMTWSPRNRTGEEDDDDLDDINPNERPSSSTSDLFDCSIKEETSIDEASTPLNETSSPLLKTEDQSPKKPKIWSIAETITSTPSSTSATSISQQDNKLVSSPKDNSSISLSSSNMPFPSGVFSNGFPHPFVGTANQALPNFSFPQNGFLQWQQQMAALAAMSRQMPMGMRPEMLQMMQGFPQMQGNNLFHNMMAATAVAPQTSSSSTTSSIPTPSSSVPLDSTTALAAAVAAVSKNDVSEDNLLKVQTSVPVNINNFTSNDDKKENGKSTTSKPSSPEYNTNSQKSEDNITSNNENSE"
     misc_feature    order(322..330,334..336,394..396,412..414,451..453,
                     457..462,469..474,478..486,490..495)
                     /locus_tag="SRAE_2000258700"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(322..324,331..333,460..462,469..474,481..483)
                     /locus_tag="SRAE_2000258700"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    367..486
                     /locus_tag="SRAE_2000258700"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:310480"
ORIGIN      
atgaataacgatgcaattaggtttttatctgccagtggtcctttattaggtcctggtttttctggttttccttctactaatatgataaatcctggagcagctgctgttgcagctcaggctgttgctgatgcaaataattttcgtgcagcttttgctgcaaatcaagcccaaacacttcaatttccaggtctttatccacaattaacaccggatatgaaaccagatatgttggcaacagcagttgcaggaagtggtatgccaccatatatgtttgatccatctataggttttcatccatatgggggtggatttgatggtggtagaagaaaaaatgcaaccagagaaacaacagcaccattaaaacaatggttaaatgaacatcgaaaaaatccttatcctacaaaagcagaaaaaattatgttagctttattaacaaaaatgtcacttacacaagttagtacatggtttgcaaatgctagaagaagattaaaaaaagaaaataaaatgacatggtctccaagaaatagaacaggtgaggaggacgatgatgatttagatgatattaatccaaatgaaaggccttcatcttctacatctgatctctttgattgttcaataaaagaagaaacatcaattgatgaagcttcaactccacttaatgaaacatcatcaccattactaaaaacagaagaccaatctcctaaaaagcctaaaatatggtctattgcagaaacaataacatcaacaccttcctcaacctctgcaacctcaatatcacaacaagataataaattagtttcatcaccaaaagataattcatctatatcactttcttcatcaaatatgcccttcccatccggtgttttttcaaatggctttccacatccttttgtgggtacggcaaatcaagctttacctaatttctcatttccacaaaacggttttcttcaatggcaacaacaaatggctgcattagcagcaatgtcaagacaaatgcctatgggtatgcgaccagaaatgttacaaatgatgcaaggttttcctcaaatgcagggaaataatttatttcataatatgatggctgctactgctgtagctccacaaacatcatcttcatcaacaacgtcatccattccaacaccatcttctagtgtgccattagattctactactgcgctggctgcggctgtagctgctgtatcaaaaaatgatgtttcagaagacaatttattaaaagtccaaacatcggtaccagttaacattaacaacttcacaagcaatgatgataaaaaggaaaatggaaaatcaacaacatcaaaaccatcttctcctgaatataatacaaattcacaaaaatctgaagataatataacatctaacaatgaaaatagtgaatag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]