LOCUS       XM_023848871             852 bp    mRNA    linear   INV 22-APR-2020
DEFINITION  PREDICTED: Cryptotermes secundus peptidyl-prolyl cis-trans
            isomerase H (LOC111862973), transcript variant X2, mRNA.
ACCESSION   XM_023848871
VERSION     XM_023848871.2
DBLINK      BioProject: PRJNA432597
KEYWORDS    RefSeq.
SOURCE      Cryptotermes secundus
  ORGANISM  Cryptotermes secundus
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Polyneoptera; Dictyoptera; Blattodea;
            Blattoidea; Termitoidae; Kalotermitidae; Cryptotermitinae;
            Cryptotermes.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019724759.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 22, 2020 this sequence version replaced XM_023848871.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Cryptotermes secundus Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..852
                     /organism="Cryptotermes secundus"
                     /mol_type="mRNA"
                     /isolation_source="Pool of workers"
                     /db_xref="taxon:105785"
                     /chromosome="Unknown"
                     /tissue_type="whole body"
                     /country="Australia"
                     /collection_date="2012"
     gene            1..852
                     /gene="LOC111862973"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111862973"
     CDS             92..550
                     /gene="LOC111862973"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase H isoform
                     X2"
                     /protein_id="XP_023704639.1"
                     /db_xref="GeneID:111862973"
                     /translation="

MILELFADVVPKTCENFREFCTGEYRRDGVPLGYKGAIFHRVIKDFMIQGGDFVNGDGTGVMSVYGGGTFADENFNLKHDAPGLLSMANSGKDTNGCQFFITCAKCNFLDGKHVVFGRVVDGLLVMRKIENVPTGPNNKPKIPVVISQCGQM"

     misc_feature    92..541
                     /gene="LOC111862973"
                     /note="cyclophilin-type peptidylprolyl cis- trans
                     isomerases. This family contains eukaryotic, bacterial and
                     archeal proteins which exhibit a peptidylprolyl cis- trans
                     isomerases activity (PPIase, Rotamase) and in addition
                     bind the immunosuppressive drug...; Region: cyclophilin;
                     cl00197"
                     /db_xref="CDD:444740"
     misc_feature    order(212..214,218..220,227..232,236..238,353..358,
                     383..385,389..391,413..418,428..430)
                     /gene="LOC111862973"
                     /note="active site"
                     /db_xref="CDD:238194"
ORIGIN      

gatcacggtgatcacggatctgactgtcaaactacctaacggttactgagttgggtagtgtggtatcgacggttgagaggaaattggacgaatgatacttgagctttttgcagatgttgtaccaaagacatgtgaaaattttagagaattttgtacaggggagtatcgacgagatggtgtgcctcttggatataagggagcaatattccaccgtgttataaaagacttcatgattcagggtggagattttgtaaatggtgatggtacaggagtgatgagtgtgtatggtggaggaacatttgcagatgagaatttcaacttgaagcatgatgctcctggtttattatctatggcaaacagtggtaaagacacaaatggatgtcagtttttcattacatgtgcaaagtgcaacttcctggatggaaaacatgttgtgtttggtagagtcgtggatggactgctggtgatgagaaaaatagagaatgttcctacaggtccaaacaacaaaccaaaaattccagttgtcatatcacagtgtggtcagatgtaatgccattcatgtataagacttgaagttctcagtgatgaagattcatgcattgtcttgactatgatagcctgttgcagtctaatagctaggttccaccaacattccaaagaatttactagagtaggagacagtgagttcctccagaacattggtactcatctgcaagactacatcagaggtcataatgacctagatcacagtatgaattattcatatgcttgagatgatgcacatcagttacaaactttccaagatacaatatctaaataaagactgacacaatccaaaatgaaaattctgta

//