2024-04-26 06:33:41, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_022601045 318 bp mRNA linear PLN 04-FEB-2020 DEFINITION Kuraishia capsulata CBS 1993 uncharacterized protein (KUCA_T00004322001), partial mRNA. ACCESSION XM_022601045 VERSION XM_022601045.1 DBLINK BioProject: PRJNA264007 BioSample: SAMEA3138920 KEYWORDS RefSeq. SOURCE Kuraishia capsulata CBS 1993 ORGANISM Kuraishia capsulata CBS 1993 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetales incertae sedis; Kuraishia. REFERENCE 1 AUTHORS Morales,L., Noel,B., Porcel,B., Marcet-Houben,M., Hullo,M.-F., Sacerdot,C., Tekaia,F., Leh-Louis,V., Despons,L., Khanna,V., Aury,J.-M., Barbe,V., Couloux,A., Labadie,K., Pelletier,E., Souciet,J.-L., Boekhout,T., Gabaldon,T., Wincker,P. and Dujon,B. TITLE Complete DNA sequence of /Kuraishia capsulata/ illustrates novel genomic features among budding yeasts (/Saccharomycotina/) JOURNAL Unpublished REFERENCE 2 (bases 1 to 318) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-FEB-2020) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 318) AUTHORS Genoscope -,C.E.A. TITLE Direct Submission JOURNAL Submitted (04-DEC-2013) Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr) COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_019172954). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..318 /organism="Kuraishia capsulata CBS 1993" /mol_type="mRNA" /strain="CBS 1993" /type_material="culture from type material of Hansenula capsulata" /db_xref="taxon:1382522" /chromosome="Unknown" /note="Kuraishia_capsulata_scaffold_5" gene <1..>318 /locus_tag="KUCA_T00004322001" /db_xref="GeneID:34521718" CDS 1..318 /locus_tag="KUCA_T00004322001" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_022460330.1" /db_xref="GeneID:34521718" /db_xref="GOA:W6MX63" /db_xref="InterPro:IPR000509" /db_xref="UniProtKB/TrEMBL:W6MX63" /translation="
MIQQRFEVEDSIAAGVNKGHKVTAKEVAPKISYRKGALSKRTAFVRDIVREVSGLAPYERRVIELIRNAGEKRAKKLAKKRLGTHLRAKAKVEEMNKIIQESRRH"
misc_feature 34..312 /locus_tag="KUCA_T00004322001" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:426088" ORIGIN
atgatacaacaacgctttgaggttgaagacagtatcgccgctggtgttaacaagggtcacaaagtgaccgctaaggaggttgccccaaaaatctcgtacagaaagggtgctttgtccaagagaaccgccttcgtcagagacattgtccgtgaagtgtccggtttggctccatacgagagacgtgtcattgagttgatcagaaatgctggtgagaagcgtgccaagaagctggccaagaagagattgggaactcacttgagagccaaggccaaggttgaggagatgaacaagatcatccaagagtctagacgtcactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]