ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-10-26 00:02:48, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_022601045 318 bp mRNA linear PLN 04-FEB-2020
DEFINITION Kuraishia capsulata CBS 1993 uncharacterized protein
(KUCA_T00004322001), partial mRNA.
ACCESSION XM_022601045
VERSION XM_022601045.1
DBLINK BioProject: PRJNA264007
BioSample: SAMEA3138920
KEYWORDS RefSeq.
SOURCE Kuraishia capsulata CBS 1993
ORGANISM Kuraishia capsulata CBS 1993
Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
Pichiomycetes; Pichiales; Pichiaceae; Kuraishia.
REFERENCE 1
AUTHORS Morales,L., Noel,B., Porcel,B., Marcet-Houben,M., Hullo,M.-F.,
Sacerdot,C., Tekaia,F., Leh-Louis,V., Despons,L., Khanna,V.,
Aury,J.-M., Barbe,V., Couloux,A., Labadie,K., Pelletier,E.,
Souciet,J.-L., Boekhout,T., Gabaldon,T., Wincker,P. and Dujon,B.
TITLE Complete DNA sequence of /Kuraishia capsulata/ illustrates novel
genomic features among budding yeasts (/Saccharomycotina/)
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 318)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (04-FEB-2020) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 318)
AUTHORS Genoscope -,C.E.A.
TITLE Direct Submission
JOURNAL Submitted (04-DEC-2013) Genoscope - Centre National de Sequencage :
BP 191 91006 EVRY cedex -FRANCE (E-mail : seqref@genoscope.cns.fr -
Web : www.genoscope.cns.fr)
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_019172954).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..318
/organism="Kuraishia capsulata CBS 1993"
/mol_type="mRNA"
/strain="CBS 1993"
/type_material="culture from type material of Hansenula
capsulata"
/db_xref="taxon:1382522"
/chromosome="Unknown"
/note="Kuraishia_capsulata_scaffold_5"
gene <1..>318
/locus_tag="KUCA_T00004322001"
/db_xref="GeneID:34521718"
CDS 1..318
/locus_tag="KUCA_T00004322001"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_022460330.1"
/db_xref="GeneID:34521718"
/db_xref="GOA:W6MX63"
/db_xref="InterPro:IPR000509"
/db_xref="UniProtKB/TrEMBL:W6MX63"
/translation="
MIQQRFEVEDSIAAGVNKGHKVTAKEVAPKISYRKGALSKRTAFVRDIVREVSGLAPYERRVIELIRNAGEKRAKKLAKKRLGTHLRAKAKVEEMNKIIQESRRH"
misc_feature 34..312
/locus_tag="KUCA_T00004322001"
/note="Ribosomal protein L36e; Region: Ribosomal_L36e;
pfam01158"
/db_xref="CDD:460088"
ORIGIN
atgatacaacaacgctttgaggttgaagacagtatcgccgctggtgttaacaagggtcacaaagtgaccgctaaggaggttgccccaaaaatctcgtacagaaagggtgctttgtccaagagaaccgccttcgtcagagacattgtccgtgaagtgtccggtttggctccatacgagagacgtgtcattgagttgatcagaaatgctggtgagaagcgtgccaagaagctggccaagaagagattgggaactcacttgagagccaaggccaaggttgaggagatgaacaagatcatccaagagtctagacgtcactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]