2024-04-20 03:40:33, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_021443097 417 bp mRNA linear PLN 09-JUN-2017 DEFINITION PREDICTED: Herrania umbratica uncharacterized LOC110427542 (LOC110427542), mRNA. ACCESSION XM_021443097 VERSION XM_021443097.1 DBLINK BioProject: PRJNA389730 KEYWORDS RefSeq; includes ab initio. SOURCE Herrania umbratica ORGANISM Herrania umbratica Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Herrania. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_018397275.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Herrania umbratica Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..417 /organism="Herrania umbratica" /mol_type="mRNA" /cultivar="Fairchild" /db_xref="taxon:108875" /chromosome="Unknown" /tissue_type="leaf" /dev_stage="mature" /country="USA: Fairchild Tropical Gardens, Miami, FL" /collection_date="2016-10" /collected_by="Dayana Rodezno" gene 1..417 /gene="LOC110427542" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:110427542" CDS 1..417 /gene="LOC110427542" /codon_start=1 /product="uncharacterized protein LOC110427542" /protein_id="XP_021298772.1" /db_xref="GeneID:110427542" /translation="
MAECSSIRPHVLKMIELIERLGQLGLAMDHELSIDLVLQSLLDSFSQFMLNFHMNRLEATFLELLNMLNMVEWSIRKDKGSLLLVSSFEAHTKQQKKKAQKGKKVKSQNEKVLKPKRGVKKDKEKDILPSLWQTWALE"
misc_feature <1..>144 /gene="LOC110427542" /note="gag-polypeptide of LTR copia-type; Region: Retrotran_gag_2; pfam14223" /db_xref="CDD:433786" ORIGIN
atggcagaatgcagttctattagaccccatgtgctgaagatgattgaactcatcgagagacttggacaattgggattagcaatggatcatgagcttagtatagacttagttctacaatctcttcttgacagctttagtcagttcatgttgaacttccatatgaatcgattggaagccacttttcttgaacttttgaatatgctaaacatggtagagtggtccatcaggaaagataaaggatcattgcttcttgtttcttcttttgaggctcatacgaaacaacagaagaagaaagcccaaaaagggaagaaggtaaaatctcaaaatgagaaggtgctgaagcctaagagaggtgtcaaaaaggacaaagagaaagatattttgccatcattgtggcaaacttgggcattggaatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]