LOCUS       XM_021033133             391 bp    mRNA    linear   PLN 11-MAY-2017
DEFINITION  PREDICTED: Arabidopsis lyrata subsp. lyrata ubiquitin-conjugating
            enzyme E2 36-like (LOC110230388), mRNA.
ACCESSION   XM_021033133
VERSION     XM_021033133.1
DBLINK      BioProject: PRJNA49545
KEYWORDS    RefSeq.
SOURCE      Arabidopsis lyrata subsp. lyrata
  ORGANISM  Arabidopsis lyrata subsp. lyrata
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_003302553.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Arabidopsis lyrata subsp. lyrata
                                           Annotation Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..391
                     /organism="Arabidopsis lyrata subsp. lyrata"
                     /mol_type="mRNA"
                     /sub_species="lyrata"
                     /bio_material="NASC:donor number MN47"
                     /db_xref="taxon:81972"
                     /chromosome="Unknown"
     gene            1..391
                     /gene="LOC110230388"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 12 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:110230388"
     CDS             34..267
                     /gene="LOC110230388"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 36-like"
                     /protein_id="XP_020888792.1"
                     /db_xref="GeneID:110230388"
                     /translation="

MSSMVMKMMGMFHMYLLVTELWRICGILSLQRWLKERDFHINSSRYFNVMILGPTQSPYEGVGFESRSKYLFGKVSI"

     misc_feature    151..>216
                     /gene="LOC110230388"
                     /note="Ubiquitin-conjugating enzyme E2, catalytic (UBCc)
                     domain/ubiquitin E2 variant (UEV) domain; Region:
                     UBCc_UEV; cl49610"
                     /db_xref="CDD:483950"
ORIGIN      

gtgattttagacattgggaaatggtggaatcatatgagcagcatggtgatgaaaatgatgggcatgttccatatgtaccttctggtgacagaattatggaggatatgcgggattctatcactacagagatggctgaaggaacgagacttccatattaacagctcccggtatttcaatgttatgattcttggacctacacaatcaccttatgaaggagttgggtttgaatcgagaagcaaatacttgtttggtaaagtctctatctagattaagcaaatcgaggaacaaaaccaatctcttcttgctctgttttaagacactgctttgattattatgtccctaatcttacattatgaatgtatttcactaaagcagtgacattggttggttt

//