ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-03-05 14:26:59, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_018850338 306 bp mRNA linear PLN 28-AUG-2017
DEFINITION Isaria fumosorosea ARSEF 2679 hypothetical protein (ISF_06734),
partial mRNA.
ACCESSION XM_018850338
VERSION XM_018850338.1
DBLINK BioProject: PRJNA342686
BioSample: SAMN04908328
KEYWORDS RefSeq.
SOURCE Cordyceps fumosorosea ARSEF 2679
ORGANISM Cordyceps fumosorosea ARSEF 2679
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
Cordyceps.
REFERENCE 1 (bases 1 to 306)
AUTHORS Shang,Y., Xiao,G., Zheng,P., Cen,K., Zhan,S. and Wang,C.
TITLE Divergent and convergent evolution of fungal pathogenicity
JOURNAL Genome Biol Evol (2016) In press
PUBMED 27071652
REMARK Publication Status: Available-Online prior to print
REFERENCE 2 (bases 1 to 306)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (28-AUG-2017) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 306)
AUTHORS Hu,X., Xiao,G., Shang,Y., Chen,P., Huang,W., Chen,Y., Xu,Y.-J. and
Wang,C.
TITLE Direct Submission
JOURNAL Submitted (03-DEC-2013) Institute of Plant Phyiology and Ecology,
Shanghai Institutes for Biological Sciences, 300 Fengling Road,
Shanghai, Shanghai 200032, China
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_017387318).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..306
/organism="Cordyceps fumosorosea ARSEF 2679"
/mol_type="mRNA"
/strain="ARSEF 2679"
/host="Popillia japonica"
/db_xref="taxon:1081104"
/chromosome="Unknown"
/geo_loc_name="Portugal: Azores"
/collection_date="Oct-1988"
gene <1..>306
/locus_tag="ISF_06734"
/db_xref="GeneID:30023026"
CDS 1..306
/locus_tag="ISF_06734"
/codon_start=1
/product="hypothetical protein"
/protein_id="XP_018702378.1"
/db_xref="GeneID:30023026"
/translation="
MAALALLHFPPRNIGEVKVTWATPLWGGKDNCHNYQYGNAIKMANCYQGSFQCNFFYNKDYTGASTKLFYNGQCVGGAQQLKSFACYYYVQVVLGGGLENV"
ORIGIN
atggctgctcttgctcttctgcatttcccgcctcggaacatcggtgaggtcaaggtgacctgggccacaccgctgtggggtggcaaggacaactgccacaattaccagtacggcaacgccatcaagatggccaactgctaccaggggagcttccagtgcaacttcttctacaacaaggactacacgggcgcgtcgacgaagctcttctacaacgggcagtgcgtcggcggcgcgcagcagctcaagtcgtttgcgtgctactactatgtacaagtagttttgggtggtggtctggaaaatgtatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]