2025-07-19 09:10:21, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_018759114 487 bp mRNA linear VRT 22-MAY-2019 DEFINITION PREDICTED: Scleropages formosus C-C motif chemokine ligand 28 (ccl28), mRNA. ACCESSION XM_018759114 VERSION XM_018759114.1 DBLINK BioProject: PRJNA540586 KEYWORDS RefSeq. SOURCE Scleropages formosus (Asian bonytongue) ORGANISM Scleropages formosus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Osteoglossocephala; Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_041822.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Scleropages formosus Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..487 /organism="Scleropages formosus" /mol_type="mRNA" /db_xref="taxon:113540" /chromosome="17" gene 1..487 /gene="ccl28" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns" /db_xref="GeneID:108938527" CDS 1..297 /gene="ccl28" /codon_start=1 /product="C-C motif chemokine 28" /protein_id="XP_018614630.1" /db_xref="GeneID:108938527" /translation="
MDLRLAAVLLLLCATFTISEGGIPRCCVKISQKIPQRLLKHVEKYDFQTSSGFCDIPALVLYMKRKKFCADPSLINKVINAINKRRKQVPQDLFGMIK"
misc_feature 73..252 /gene="ccl28" /note="Small cytokines (intecrine/chemokine), interleukin-8 like; Region: IL8; pfam00048" /db_xref="CDD:459650" ORIGIN
atggatctgagattggcagcagttctcttgctcctgtgcgccacctttaccatcagtgaaggtggaattccaaggtgctgtgtgaagataagtcaaaaaatccctcaacgcttactgaaacacgtggagaagtatgacttccaaacgtcctctggattttgtgacattcctgctctggtactgtacatgaaacggaagaaattctgcgctgaccccagcctcataaataaggtgataaatgcgataaataaaagaagaaaacaggtaccgcaggacctgttcggaatgattaagtaaatggtgtgtggtggaaggtcatggtgacctctgaattgcttccttaatataatcttcatttctatgacctatggaatggtctggtgtcatgcgtttttccttatgaagtttggtgaaaattttcactcttgtattatgttttactgcatgtcgtacccagatttttgatatcttgtgatgttctgtacaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]