GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-19 09:10:21, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_018759114             487 bp    mRNA    linear   VRT 22-MAY-2019
DEFINITION  PREDICTED: Scleropages formosus C-C motif chemokine ligand 28
            (ccl28), mRNA.
ACCESSION   XM_018759114
VERSION     XM_018759114.1
DBLINK      BioProject: PRJNA540586
KEYWORDS    RefSeq.
SOURCE      Scleropages formosus (Asian bonytongue)
  ORGANISM  Scleropages formosus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Osteoglossocephala;
            Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_041822.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Scleropages formosus Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..487
                     /organism="Scleropages formosus"
                     /mol_type="mRNA"
                     /db_xref="taxon:113540"
                     /chromosome="17"
     gene            1..487
                     /gene="ccl28"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 13 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 3 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:108938527"
     CDS             1..297
                     /gene="ccl28"
                     /codon_start=1
                     /product="C-C motif chemokine 28"
                     /protein_id="XP_018614630.1"
                     /db_xref="GeneID:108938527"
                     /translation="
MDLRLAAVLLLLCATFTISEGGIPRCCVKISQKIPQRLLKHVEKYDFQTSSGFCDIPALVLYMKRKKFCADPSLINKVINAINKRRKQVPQDLFGMIK"
     misc_feature    73..252
                     /gene="ccl28"
                     /note="Small cytokines (intecrine/chemokine),
                     interleukin-8 like; Region: IL8; pfam00048"
                     /db_xref="CDD:459650"
ORIGIN      
atggatctgagattggcagcagttctcttgctcctgtgcgccacctttaccatcagtgaaggtggaattccaaggtgctgtgtgaagataagtcaaaaaatccctcaacgcttactgaaacacgtggagaagtatgacttccaaacgtcctctggattttgtgacattcctgctctggtactgtacatgaaacggaagaaattctgcgctgaccccagcctcataaataaggtgataaatgcgataaataaaagaagaaaacaggtaccgcaggacctgttcggaatgattaagtaaatggtgtgtggtggaaggtcatggtgacctctgaattgcttccttaatataatcttcatttctatgacctatggaatggtctggtgtcatgcgtttttccttatgaagtttggtgaaaattttcactcttgtattatgttttactgcatgtcgtacccagatttttgatatcttgtgatgttctgtacaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]