GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-24 17:33:35, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_018709905             772 bp    mRNA    linear   INV 10-JAN-2018
DEFINITION  PREDICTED: Anoplophora glabripennis transcription factor MafK
            (LOC108906600), mRNA.
ACCESSION   XM_018709905
VERSION     XM_018709905.1
DBLINK      BioProject: PRJNA348318
KEYWORDS    RefSeq.
SOURCE      Anoplophora glabripennis (Asian longhorned beetle)
  ORGANISM  Anoplophora glabripennis
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Coleoptera; Polyphaga;
            Cucujiformia; Chrysomeloidea; Cerambycidae; Lamiinae; Lamiini;
            Anoplophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019416472.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Anoplophora glabripennis Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..772
                     /organism="Anoplophora glabripennis"
                     /mol_type="mRNA"
                     /isolate="ALB-LARVAE"
                     /isolation_source="'mixed' research colony (originating
                     from wild-collected US specimens from several localities)"
                     /db_xref="taxon:217634"
                     /chromosome="Unknown"
                     /country="USA: Otis Air National Guard Base, MA"
                     /collection_date="Aug-2011"
     gene            1..772
                     /gene="LOC108906600"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 12 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 13 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:108906600"
     CDS             157..555
                     /gene="LOC108906600"
                     /codon_start=1
                     /product="transcription factor MafK"
                     /protein_id="XP_018565421.1"
                     /db_xref="GeneID:108906600"
                     /translation="
MPQESKKNAKLAPLSPSPLLDISDDELVSISVRDLNRQLKLRGLSRDEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETEKTQEWRDLEVMKDELIHMREEMSGMTSRYEALKQFAISNKIPIPPDLEHF"
     misc_feature    292..498
                     /gene="LOC108906600"
                     /note="Basic leucine zipper (bZIP) domain of small
                     musculoaponeurotic fibrosarcoma (Maf) proteins: a
                     DNA-binding and dimerization domain; Region:
                     bZIP_Maf_small; cd14717"
                     /db_xref="CDD:269865"
     misc_feature    292..498
                     /gene="LOC108906600"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:269865"
     misc_feature    order(322..330,334..342,346..351,358..363,367..372)
                     /gene="LOC108906600"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:269865"
     misc_feature    order(370..372,379..384,391..396,400..405,412..417,
                     421..426,433..435,442..447,454..456,463..468,475..480)
                     /gene="LOC108906600"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:269865"
ORIGIN      
ttttgtgcaatcaaaacatagttcatggcgttttatctttctacgttctatatttcttagcatgacttgcacaaactcatcaaaaggtgcagcagatgtaaaatatttaaagaactatcttcaaaatataacgtgaagtaattctaaaaattcaacatgcctcaagaatctaaaaagaatgcgaaacttgctcccttatcgccatcgcctttgctggatatatctgatgatgaattggtgagtatctcggtgcgagatttaaacaggcaattaaagttgagaggattgtccagagatgagattgttcgaatgaaacaaagaagacgaacattgaagaatagaggatatgctgcatcttgtcgaattaaaagaattgaacaaaaagatgaactagaaactgagaaaacacaagagtggagagatttggaagttatgaaggacgaacttattcacatgagggaagaaatgtctggaatgactagtcgttatgaagcactgaagcaatttgctattagcaataaaattcccattccaccagacctagaacatttttaacatttgatttatatcacatgagaaatgtttagctttattataatgactcgagacaaaagtaaagaatagctttttagagaatactattaaagtattaatatacattttttatatatcttgaaattacaatgtgaatttcaaaatgtatattcataaaatactataattccagcagtttgaacggatatgtggagtaataaaagtagttgaaaaactt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]