2025-07-03 11:08:51, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_018367307 303 bp mRNA linear PLN 04-DEC-2024 DEFINITION Saccharomyces eubayanus 60S ribosomal protein eL36 (DI49_4277), partial mRNA. ACCESSION XM_018367307 VERSION XM_018367307.1 DBLINK BioProject: PRJNA342694 BioSample: SAMN02716114 KEYWORDS RefSeq. SOURCE Saccharomyces eubayanus ORGANISM Saccharomyces eubayanus Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 303) AUTHORS Baker,E., Wang,B., Bellora,N., Peris,D., Hulfachor,A.B., Koshalek,J.A., Adams,M., Libkind,D. and Hittinger,C.T. TITLE The Genome Sequence of Saccharomyces eubayanus and the Domestication of Lager-Brewing Yeasts JOURNAL Mol. Biol. Evol. 32 (11), 2818-2831 (2015) PUBMED 26269586 REFERENCE 2 (bases 1 to 303) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (03-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 303) AUTHORS Wang,B., Baker,E., Libkind,D., Goncalves,P., Sampaio,J.P. and Hittinger,C.T. TITLE Direct Submission JOURNAL Submitted (05-MAY-2015) Laboratory of Genetics, University of Wisconsin-Madison, 425-G Henry Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_030972). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..303 /organism="Saccharomyces eubayanus" /mol_type="mRNA" /strain="FM1318" /isolation_source="Nothofagus dombeyi infected by Cyttaria hariotii" /host="Cyttaria hariotii" /db_xref="taxon:1080349" /chromosome="XIII" /geo_loc_name="Argentina: Nahuel Huapi, Patagonia" /lat_lon="41.3569 S 71.5157 W" /altitude="906 m" /collection_date="2006" /collected_by="R. Ulloa, Diego Libkind" /identified_by="R. Ulloa, Diego Libkind" gene <1..>303 /locus_tag="DI49_4277" /note="SEUB0M03270" /db_xref="GeneID:28933414" CDS 1..303 /locus_tag="DI49_4277" /note="ancestor homolog: Anc_6.283; saccharomyces cerevisiae ortholog: YMR194W" /codon_start=1 /product="60S ribosomal protein eL36" /protein_id="XP_018220241.1" /db_xref="GeneID:28933414" /translation="
MAAKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFIRAKAKVEEMNNIISASRRH"
misc_feature 10..297 /locus_tag="DI49_4277" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:460088" ORIGIN
atggccgctaagacaggaatcgcaattggtttgaacaaaggtaagaaggtcactagcatgaccccagccccaaagatctcttacaagaagggtgctgcttccaacagaactaagttcgtcagatctttggttagagaaatcgccggtttgtctccatacgaaagaagattgatcgatctaataagaaactctggtgaaaagagagctagaaaggttgccaagaagagattgggttctttcatcagagccaaggctaaggttgaagaaatgaacaacattatttctgcttctcgtcgtcactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]