GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-18 21:01:56, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_018120908             507 bp    mRNA    linear   PLN 12-SEP-2016
DEFINITION  PREDICTED: Theobroma cacao uncharacterized LOC108661919
            (LOC108661919), mRNA.
ACCESSION   XM_018120908
VERSION     XM_018120908.1
DBLINK      BioProject: PRJNA341501
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Theobroma cacao (cacao)
  ORGANISM  Theobroma cacao
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae;
            Theobroma.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_030854.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Theobroma cacao Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..507
                     /organism="Theobroma cacao"
                     /mol_type="mRNA"
                     /cultivar="B97-61/B2"
                     /db_xref="taxon:3641"
                     /chromosome="5"
     gene            1..507
                     /gene="LOC108661919"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:108661919"
     CDS             1..507
                     /gene="LOC108661919"
                     /codon_start=1
                     /product="uncharacterized protein LOC108661919"
                     /protein_id="XP_017976397.1"
                     /db_xref="GeneID:108661919"
                     /translation="
MANNLSLRSILDANTLTGPNFFDLFRNLKIVLKQKKKSYVLNIPIPPVPVANVNVEDKEAYQRHKDDDDQAACVMLTSMTPELQKQYEHMDVQSIILHLRKLFDKEWRIERYEISKELFRCKMVEMSFLRPHVPKMIGLIERLRQLGLAMDHGLSIDLILQSLLDSFS"
ORIGIN      
atggctaataatctgtcactgcggagcatcttggatgcaaatactctcactggcccaaacttctttgatttgtttcggaacctcaagatcgtcttgaaacagaagaagaaatcctatgtccttaacattcctattccaccagtccctgttgctaatgttaatgttgaggataaggaagcatatcaacgtcataaggatgacgatgatcaggcagcatgcgtgatgctaaccagtatgactcctgagctccaaaagcagtatgagcacatggatgtccaatccataattcttcatcttagaaaattgttcgataaggaatggcgcattgagagatatgagatctctaaagaactattccgatgcaagatggtagaaatgagttttcttagaccccatgtgccgaagatgattggactcatcgagagacttagacaattgggattagcaatggatcatgggctaagtatagacttaattctacaatctcttcttgacagcttcagttag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]