LOCUS       XM_015902947            1665 bp    mRNA    linear   INV 14-MAR-2016
DEFINITION  PREDICTED: Acropora digitifera myosin-11-like (LOC107337720), mRNA.
ACCESSION   XM_015902947
VERSION     XM_015902947.1
DBLINK      BioProject: PRJNA314803
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Acropora digitifera
  ORGANISM  Acropora digitifera
            Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Scleractinia;
            Astrocoeniina; Acroporidae; Acropora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_015441161.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Acropora digitifera Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 21% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1665
                     /organism="Acropora digitifera"
                     /mol_type="mRNA"
                     /db_xref="taxon:70779"
                     /chromosome="Unknown"
                     /country="Japan:Okinawa, Kunigami, Oku"
     gene            1..1665
                     /gene="LOC107337720"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 Proteins, and 78% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:107337720"
     CDS             1..1665
                     /gene="LOC107337720"
                     /codon_start=1
                     /product="myosin-11-like"
                     /protein_id="XP_015758433.1"
                     /db_xref="GeneID:107337720"
                     /translation="

MSRSTPGNQHYSLMLHWFKMSATLKVCSFFMRHKSTIGKSERCVEVQTTFEAHRDFELGTPVEFPVSGGHPRFGVIRWIGNIPQEKDHLIVGLELEQKTSAFCDGTLNGTRYFTCEPGRGFFCILESCRKDSRQTSNSQNNDNILPGKDEQCEENAFSRQLASLDSSSYQQALEDIQQLINENNKLNLEKCQWEKEKNDVQQEKDELVVQNNSLQTDLRANESQVHKLETSLTTVQQALEDMQQLKDENSRLKLEKCQLEKDKNDVQEEKDELVVQNNSLQTDLRANESQVHKLETSLTTVQQALEDMQQLKDENSRLKLEKCQLEKDKNDVQEEKDELVVQNNSLQTDLRANESQVHKLETSLTTVQQALEDMQQLKDENSRLKLEKCQLEKDKNDVQEEKDELVVQNNSLQTDLRAKETQVHELETSLTTAQQALENMQQLEIRHKGLKLEKCQLEKEKNVVQQEKDELVVQNNSLQTDLRAKETQVDVYSFGVLFCEMCIREMPDPQRRHQQVLLMRNRVLRSVVLKCVRVNPAERPDMPQIIQEIEKFEG"

     misc_feature    172..387
                     /gene="LOC107337720"
                     /note="Cytoskeleton-associated proteins (CAPs) are
                     involved in the organisation of microtubules and
                     transportation of vesicles and organelles along the
                     cytoskeletal network; Region: CAP_GLY; smart01052"
                     /db_xref="CDD:214997"
     misc_feature    583..>1458
                     /gene="LOC107337720"
                     /note="Chromosome segregation ATPase [Cell cycle control,
                     cell division, chromosome partitioning]; Region: Smc;
                     COG1196"
                     /db_xref="CDD:224117"
     misc_feature    <1462..1647
                     /gene="LOC107337720"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl21453"
                     /db_xref="CDD:451246"
ORIGIN      

atgtctagatccacccctggcaatcaacattacagtttgatgctgcactggtttaaaatgagtgcaacgttaaaagtgtgtagtttcttcatgagacacaaaagcacaataggaaaatctgaaaggtgtgttgaagttcaaacaacctttgaagctcatcgtgactttgaactgggcactcctgtcgagtttcccgtgtcaggaggtcacccaagatttggtgtcatacgatggattggaaatattccacaagaaaaggatcatcttattgttggcttggagttggagcagaaaacgtctgctttttgcgatggaacattgaatggaacgagatatttcacctgtgaaccaggaagaggtttcttctgtattttggagagctgcagaaaagactcacgccaaacttcaaattcacaaaacaatgataacattcttcctggcaaagatgaacagtgtgaagaaaatgcattttcaaggcaattagcttcacttgactcatcttcatatcaacaagctttggaagacatccagcaactgataaatgaaaacaacaaattgaatcttgaaaaatgccagtgggagaaagagaaaaatgatgtgcaacaagaaaaggatgaacttgtggttcaaaacaatagtttgcaaacagatttgagagcaaatgaatcccaagtacacaaactagaaacatctctcactacagttcaacaagctttggaggatatgcagcaactgaaagatgaaaacagcagattaaagcttgaaaagtgccagttggagaaagacaagaatgatgtgcaagaagaaaaggatgaacttgtggttcaaaacaatagtttgcaaacagatttgagagcaaatgaatcccaagtacacaaactagaaacatctctcactacagttcaacaagctttggaggatatgcagcaactgaaagatgaaaacagcagattaaagcttgaaaagtgccagttggagaaagacaagaatgatgtgcaagaagaaaaggatgaacttgtggttcaaaacaatagtttgcaaacagatttgagagcaaatgaatcccaagtacacaaactagaaacatctctcactacagttcaacaagctttggaggatatgcagcaactgaaagatgaaaacagcagattaaagcttgaaaagtgccagttggagaaagacaagaatgatgtgcaagaagaaaaggatgaacttgtggttcaaaacaatagtttgcaaacagatttgagagcaaaggaaactcaggtgcacgaactggaaacatctctcactacagctcaacaagctttggagaatatgcagcaactggaaattcgccacaaaggattgaagcttgaaaaatgccagttggagaaagagaaaaatgttgtgcaacaagaaaaggatgaacttgtggttcaaaacaatagtttgcaaacagatttgagagcaaaggaaactcaggttgatgtgtacagctttggtgtccttttctgtgaaatgtgcattcgggaaatgccagatccacaaagacgtcatcaacaagttcttcttatgagaaaccgtgttctaaggagcgtagtgcttaaatgcgtgagggtcaatccagctgagagacctgacatgccacaaattatccaagaaatagaaaagtttgaaggatga

//