GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-25 07:23:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_014312835             294 bp    mRNA    linear   PLN 29-DEC-2023
DEFINITION  Grosmannia clavigera kw1407 uncharacterized protein (CMQ_4679),
            partial mRNA.
ACCESSION   XM_014312835
VERSION     XM_014312835.1
DBLINK      BioProject: PRJNA264104
            BioSample: SAMN02953765
KEYWORDS    RefSeq.
SOURCE      Grosmannia clavigera kw1407
  ORGANISM  Grosmannia clavigera kw1407
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Ophiostomatales;
            Ophiostomataceae; Leptographium.
REFERENCE   1  (bases 1 to 294)
  AUTHORS   Diguistini,S., Wang,Y., Liao,N.Y., Taylor,G., Tanguay,P., Feau,N.,
            Henrissat,B., Chan,S.K., Hesse-Orce,U., Alamouti,S.M., Tsui,C.K.,
            Docking,R.T., Levasseur,A., Haridas,S., Robertson,G., Birol,I.,
            Holt,R.A., Marra,M.A., Hamelin,R.C., Hirst,M., Jones,S.J.,
            Bohlmann,J. and Breuil,C.
  TITLE     Genome and transcriptome analyses of the mountain pine
            beetle-fungal symbiont Grosmannia clavigera, a lodgepole pine
            pathogen
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. (2011) In press
   PUBMED   21262841
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 294)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 294)
  AUTHORS   DiGuistini,S., Wang,Y., Liao,N.Y., Tanguay,P., Feau,N.,
            Henrissat,B., Chan,S.K., Hesse-Orce,U., Alamouti,S.M., Tsui,C.K.,
            Docking,T.R., Levasseur,A., Haridas,S., Robertson,G., Birol,I.,
            Holt,R.A., Marra,M.A., Hirst,M., Hamelin,R.C., Jones,S.J.M.,
            Bohlmann,J.R. and Breuil,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-DEC-2010) Wood Science, University of British
            Columbia, Faculty of Forestry The University of British Columbia
            4th floor, Vancouver, British Columbia V6T 1Z4, Canada
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_014040560).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..294
                     /organism="Grosmannia clavigera kw1407"
                     /mol_type="mRNA"
                     /strain="kw1407"
                     /culture_collection="UAMH:11150"
                     /db_xref="taxon:655863"
                     /chromosome="Unknown"
     gene            <1..>294
                     /locus_tag="CMQ_4679"
                     /db_xref="GeneID:25977916"
     CDS             1..294
                     /locus_tag="CMQ_4679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_014168310.1"
                     /db_xref="GeneID:25977916"
                     /translation="
MPIRLARIYFRRLTIWSSLLLLTTGYFLFSDVLPDVANHALRKPLRSQWHPIDRLIDEVNMTFHRLLQSRSTNLSDAAARYRERRGRHPPPGFGAWW"
ORIGIN      
atgcctatcagactggccaggatttacttcaggcggctgaccatctggagcagtcttttgttgttgaccacgggctacttcctattctcagacgtgttgcccgacgtggccaatcatgccctacgcaagccccttcgctcgcagtggcatcctatcgaccgcttaatcgatgaggtcaacatgacctttcaccgcctcctgcagtcacgctcaacaaacttgagcgatgcagcagcgcgctaccgcgagcggcggggccgtcacccgccgcctggtttcggcgcgtggtggtag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]