GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-24 15:14:25, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_013737069             547 bp    mRNA    linear   PLN 25-AUG-2015
DEFINITION  PREDICTED: Brassica oleracea var. oleracea ubiquitin-fold modifier
            1 (LOC106300834), mRNA.
ACCESSION   XM_013737069
VERSION     XM_013737069.1
DBLINK      BioProject: PRJNA293438
KEYWORDS    RefSeq.
SOURCE      Brassica oleracea var. oleracea
  ORGANISM  Brassica oleracea var. oleracea
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Brassiceae; Brassica.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_013617411.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Brassica oleracea Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..547
                     /organism="Brassica oleracea var. oleracea"
                     /mol_type="mRNA"
                     /variety="oleracea"
                     /cultivar="TO1000"
                     /db_xref="taxon:109376"
                     /chromosome="C6"
                     /country="Canada"
                     /lat_lon="52.1333 N 106.6833 W"
                     /collection_date="31-Aug-2009"
     gene            1..547
                     /gene="LOC106300834"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 ESTs, 4 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 27 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:106300834"
     CDS             78..350
                     /gene="LOC106300834"
                     /codon_start=1
                     /product="ubiquitin-fold modifier 1"
                     /protein_id="XP_013592523.1"
                     /db_xref="GeneID:106300834"
                     /translation="
MATGGKVSFKVTLTSDPKLPFKVFSVPEGAPFTAVLKFAAEEFKVPPQTSAIITNDGIGINPQQSAGNVFLKHGSELRLIPRDRVGAAFC"
     misc_feature    96..320
                     /gene="LOC106300834"
                     /note="ubiquitin-like (Ubl) domain found in ubiquitin fold
                     modifier 1 (UFM1); Region: Ubl_UFM1; cd01766"
                     /db_xref="CDD:340465"
     misc_feature    order(141..158,168..170,177..182,189..191)
                     /gene="LOC106300834"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:340465"
ORIGIN      
aacgcgaagcaccattttcagtttttttttttccaccgtgcaagcctgatctccttcctccacccttcgccggaaagatggcaactggtgggaaagtatccttcaaggtcacactgacctcggaccctaagcttcctttcaaagtattcagcgtgccggagggagctccgttcacggcggttctgaaattcgcagcggaggagttcaaggttcctcctcaaaccagcgccatcatcaccaatgatgggatcgggattaatcctcaacagagcgcaggaaacgtgttcttgaagcatggatctgaactgagactcatcccgcgtgatagagttggagctgcgttttgttaattgatccccatgaatgctttaagcaatgagtgagaaaccaagtgacgtaccttaaaaaataaataaataaataaaccgaacttattgaaatggttaatatgcaactctttttttttttctctttgaataaaaatacacatgtgatgtttacatcaagtttagtgattacggcaattggatccaaagttagatacata
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]