2024-04-24 15:14:25, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_013737069 547 bp mRNA linear PLN 25-AUG-2015 DEFINITION PREDICTED: Brassica oleracea var. oleracea ubiquitin-fold modifier 1 (LOC106300834), mRNA. ACCESSION XM_013737069 VERSION XM_013737069.1 DBLINK BioProject: PRJNA293438 KEYWORDS RefSeq. SOURCE Brassica oleracea var. oleracea ORGANISM Brassica oleracea var. oleracea Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_013617411.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Brassica oleracea Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..547 /organism="Brassica oleracea var. oleracea" /mol_type="mRNA" /variety="oleracea" /cultivar="TO1000" /db_xref="taxon:109376" /chromosome="C6" /country="Canada" /lat_lon="52.1333 N 106.6833 W" /collection_date="31-Aug-2009" gene 1..547 /gene="LOC106300834" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns" /db_xref="GeneID:106300834" CDS 78..350 /gene="LOC106300834" /codon_start=1 /product="ubiquitin-fold modifier 1" /protein_id="XP_013592523.1" /db_xref="GeneID:106300834" /translation="
MATGGKVSFKVTLTSDPKLPFKVFSVPEGAPFTAVLKFAAEEFKVPPQTSAIITNDGIGINPQQSAGNVFLKHGSELRLIPRDRVGAAFC"
misc_feature 96..320 /gene="LOC106300834" /note="ubiquitin-like (Ubl) domain found in ubiquitin fold modifier 1 (UFM1); Region: Ubl_UFM1; cd01766" /db_xref="CDD:340465" misc_feature order(141..158,168..170,177..182,189..191) /gene="LOC106300834" /note="polypeptide substrate binding site [polypeptide binding]; other site" /db_xref="CDD:340465" ORIGIN
aacgcgaagcaccattttcagtttttttttttccaccgtgcaagcctgatctccttcctccacccttcgccggaaagatggcaactggtgggaaagtatccttcaaggtcacactgacctcggaccctaagcttcctttcaaagtattcagcgtgccggagggagctccgttcacggcggttctgaaattcgcagcggaggagttcaaggttcctcctcaaaccagcgccatcatcaccaatgatgggatcgggattaatcctcaacagagcgcaggaaacgtgttcttgaagcatggatctgaactgagactcatcccgcgtgatagagttggagctgcgttttgttaattgatccccatgaatgctttaagcaatgagtgagaaaccaagtgacgtaccttaaaaaataaataaataaataaaccgaacttattgaaatggttaatatgcaactctttttttttttctctttgaataaaaatacacatgtgatgtttacatcaagtttagtgattacggcaattggatccaaagttagatacata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]