GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-18 15:01:12, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       XM_013559232             474 bp    mRNA    linear   INV 28-FEB-2018
DEFINITION  PREDICTED: Lingula anatina protein FAM84B-like (LOC106176727),
            mRNA.
ACCESSION   XM_013559232
VERSION     XM_013559232.1
DBLINK      BioProject: PRJNA293030
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Lingula anatina
  ORGANISM  Lingula anatina
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Brachiopoda;
            Linguliformea; Lingulata; Lingulida; Linguloidea; Lingulidae;
            Lingula.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019775411.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Lingula anatina Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..474
                     /organism="Lingula anatina"
                     /mol_type="mRNA"
                     /isolate="Amm_Jpn"
                     /isolation_source="intertidal zone"
                     /db_xref="taxon:7574"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="Gonads"
                     /dev_stage="adult"
                     /geo_loc_name="Japan: Amami, Kasari Bay"
                     /lat_lon="28.4406 N 129.6676 E"
                     /collection_date="2012"
                     /collected_by="Nori Satoh, Kazuyoshi Endo"
                     /identified_by="Kazuyoshi Endo"
     gene            1..474
                     /gene="LOC106176727"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:106176727"
     CDS             1..474
                     /gene="LOC106176727"
                     /codon_start=1
                     /product="protein FAM84B-like"
                     /protein_id="XP_013414686.1"
                     /db_xref="GeneID:106176727"
                     /translation="
MEDVRRHNQAVLDSLVPGDLVEFQRSWLFSHWAVYIGNEEVVHFIERNSGGVFSSSSERSMTGVVRRDSFWTVAGRSKAFKNNRRDAKYSCDVIVTRALSKLGVSEFNLFLRNSEHFVAWCRYGEECSEQAQTIWTMFLGSMAVIVGGIAALTGLRR"
     misc_feature    82..375
                     /gene="LOC106176727"
                     /note="Lecithin retinol acyltransferase; Region: LRAT;
                     pfam04970"
                     /db_xref="CDD:398571"
ORIGIN      
atggaagacgtgaggcgtcataaccaggcagtgttagattcccttgtgccgggagacctggtggagttccaaaggtcgtggctcttctcccactgggccgtttatattggtaatgaagaagtggtccattttattgaacgcaattcaggaggtgtcttcagttcctctagtgagcgttctatgacgggggtagttcgaagggattccttttggacagtggcagggaggagtaaggcgttcaaaaacaacagaagggacgccaaatacagctgtgatgtgatagtgacgagggctctgtcaaagctgggagtgagcgagttcaatctcttcttgagaaatagtgaacattttgtagcctggtgtagatatggtgaagagtgcagtgaacaggcacaaaccatctggacaatgtttttggggtctatggctgtaattgtggggggcattgccgcactcactggccttaggcgatag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]