2024-04-20 06:21:07, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_012751099 1720 bp mRNA linear PRI 24-FEB-2017 DEFINITION PREDICTED: Microcebus murinus claudin 2 (CLDN2), transcript variant X2, mRNA. ACCESSION XM_012751099 VERSION XM_012751099.1 DBLINK BioProject: PRJNA285159 KEYWORDS RefSeq. SOURCE Microcebus murinus (gray mouse lemur) ORGANISM Microcebus murinus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Strepsirrhini; Lemuriformes; Cheirogaleidae; Microcebus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_033692.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Microcebus murinus Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.3 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1720 /organism="Microcebus murinus" /mol_type="mRNA" /isolate="mixed" /db_xref="taxon:30608" /chromosome="X" /sex="pooled male and female" /tissue_type="liver; kidney" /note="three separate animals were used in this assembly: #8(Reference animal), 1886F (Citronella), 7006M (Rosehip)" gene 1..1720 /gene="CLDN2" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 40 ESTs, 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:105863674" CDS 357..1049 /gene="CLDN2" /codon_start=1 /product="claudin-2" /protein_id="XP_012606553.1" /db_xref="GeneID:105863674" /translation="
MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPSQRNRSNYYDAYQAQPLATRSSPRPGQPPKAKSEFNSYSLTGYV"
misc_feature 423..899 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
aagtctctgacccaaggctcagatttgcagatggattttgcaaagctgtggttagcaattagaaatcctttatcacctcaggctgtggccccttgcacttcactcccctctctcaggatcccttcctccatcttcaggggcatctccccctccaaggctctgcaaaagaacggctctgtcttctagatgccttcttgagcctgcttgtggccacccacagacacttgtaaggaggagagaagtcagcttggcagaattactctgaaatgagggattagaagccgggatctgtggagcaagaactgcagccagaagaaggagcgggccctgaagacgcttctactgagaggtctgccatggcctctcttggccttcaacttgtcggctacatcctaggccttctggggctgttgggcacactggttgccatgttgctccccagttggcgaacgagttcttacgttggtgccagcattgtgacggcagtcggcttttccaagggcctctggatggagtgtgccacccacagcacaggcatcacccagtgtgacatctacagcacccttctaggcctgcccgctgacatccaggctgcccaggccatgatggtgacatccagtgcaatctcctcgctggcctgcattatctctgtggtgggcatgaggtgcacagtcttctgccaggaatccagggccaaagacagagtggcggtagtaggcggagtcttcttcatccttggaggtctcctgggcttcattcctgttgcctggaatcttcatgggatcctgcgggacttctactcaccactggtgcctgacagcatgaaatttgagatcggagaagctctttacttgggcattatttcttccctgttctccttggtggctggaatcatcctctgcttttcctgtccatcccagagaaatcgctccaactactacgatgcctaccaagcccagcctcttgccactaggagctctcccaggcctggtcagcctcccaaagccaagagtgaattcaactcctacagtctgaccgggtatgtgtgaagaaccaggggccagagctgggggtggctggggctgtggaaaccagtggacaggcccctggggccacaggtgagggacacggccactggatcatgtcagaaagtgctgctgaggatagactgactttggccactggattgagcaaaggcagaaatgggagctagtgtgacagcatgcaggttgaattgcctgcaggatgctcaccaagccagcctttctgtttccttcaccttgctctccccctgccctgagtccccaaccctaaacttgaaaccagagcccctacctttagccaggccccagaggctcccttctgccctttggtttacctgggaaaccatccccaaacccactaatcatcccggggacttactctctttgatcaaagaaagaccctctccctctggctgaggttgctcttagcttgttgctgggggatgggggggagaagtggtggcttttatgggcatggctcgaacctccttctcaagcctccctccaaagaaactgattggtcagtaatgggctgtagaacctccatcccactcttgttatgactccacagtgtccagactggtttgtgcatgaactgaaataaaaccatcccacggtatccagggaacagaaggcaactgggtgcaggatgtgaggatgggtaggcagcttgggac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]