GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-23 23:14:45, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_010680384             689 bp    mRNA    linear   PLN 13-JUN-2023
DEFINITION  PREDICTED: Beta vulgaris subsp. vulgaris hypothetical protein
            (LOC104894204), mRNA.
ACCESSION   XM_010680384
VERSION     XM_010680384.4
DBLINK      BioProject: PRJNA973951
KEYWORDS    RefSeq.
SOURCE      Beta vulgaris subsp. vulgaris
  ORGANISM  Beta vulgaris subsp. vulgaris
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_079206) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jun 13, 2023 this sequence version replaced XM_010680384.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_026745355.1-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/07/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..689
                     /organism="Beta vulgaris subsp. vulgaris"
                     /mol_type="mRNA"
                     /cultivar="EL10"
                     /sub_species="vulgaris"
                     /db_xref="taxon:3555"
                     /chromosome="5"
                     /tissue_type="leaf"
                     /dev_stage="adult"
                     /country="USA"
     gene            1..689
                     /gene="LOC104894204"
                     /note="hypothetical protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:104894204"
     CDS             202..462
                     /gene="LOC104894204"
                     /codon_start=1
                     /product="uncharacterized protein LOC104894204"
                     /protein_id="XP_010678686.1"
                     /db_xref="GeneID:104894204"
                     /translation="
MASGNTNYESSWADQWDPQPAYVSHENESKNKKKNNESGGGAKKKVEEGLTKTKEVASTSFKKVKQGTSMGISWIKDKYHKTTQKH"
     polyA_site      689
                     /gene="LOC104894204"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
ggtggaaatattcttcatttcccaccgtcatacgacattatatatatacacacaacatttcatcaaaacatttaagcaatcacaatttcaggaagcctttaaatctcaaaacaatctcttctttcttcttaaagcttaacaaattaaaacaatctcttcttgtttcttcatagttttaagattttacaagtataaataaaaatggcatcaggaaacacaaattatgagagttcatgggcagatcagtgggacccacaaccagcttatgtaagccatgaaaatgaaagcaaaaacaagaagaagaataatgaatcaggaggaggtgcaaagaagaaagttgaagaagggcttaccaaaactaaagaagttgcttctactagtttcaagaaggtcaaacagggtacttctatgggtatcagttggatcaaagacaagtatcataagaccacccaaaaacattaaatcatcatattataaacttctttttatttcatgttatgtaattatttcatttgattcatgatttatatcttaggttgatgattattatgggtatctgtatatcttatccgatctgatttgatttgatttgctttggtttgttaatcaagcaaatttttttgtaattgactattgaatcgtttctttctctttattttcttgaatatactccacttatcttttgatca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]