GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-12-06 00:15:34, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       XM_010645255            2470 bp    mRNA    linear   ROD 23-APR-2020
DEFINITION  PREDICTED: Fukomys damarensis argonaute RISC component 1 (Ago1),
            transcript variant X5, mRNA.
ACCESSION   XM_010645255
VERSION     XM_010645255.1
DBLINK      BioProject: PRJNA625221
KEYWORDS    RefSeq.
SOURCE      Fukomys damarensis (Damara mole-rat)
  ORGANISM  Fukomys damarensis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
            Hystricomorpha; Bathyergidae; Fukomys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_022900935.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Fukomys damarensis Annotation
                                           Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2470
                     /organism="Fukomys damarensis"
                     /mol_type="mRNA"
                     /isolate="Sample0158"
                     /db_xref="taxon:885580"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="blood from cranial vena cava"
                     /country="USA: Houston Zoo, Houston, TX"
                     /collection_date="05-Sep-2016"
                     /collected_by="Joseph P. Flanagan, Kelcie Pletch,
                     Christine Molter, Maryanne Tocidlowski, Lauren Howard,
                     Judilee Marrow, Andrea Lee, Jess Jimerson, Katie Plaeger,
                     Erin Neer"
     gene            1..2470
                     /gene="Ago1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 6 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:104876986"
     CDS             108..2402
                     /gene="Ago1"
                     /codon_start=1
                     /product="protein argonaute-1 isoform X5"
                     /protein_id="XP_010643557.1"
                     /db_xref="GeneID:104876986"
                     /translation="
MEAGPSGAAAGPYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRVSRNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPPAGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNERLLGLYPIYRPALREGKGNYHLLNFSYVPDTVQGVFLTATL"
     misc_feature    183..599
                     /gene="Ago1"
                     /note="N-terminal domain of argonaute; Region: ArgoN;
                     pfam16486"
                     /db_xref="CDD:293095"
     misc_feature    630..779
                     /gene="Ago1"
                     /note="Argonaute linker 1 domain; Region: ArgoL1;
                     pfam08699"
                     /db_xref="CDD:285861"
     misc_feature    780..1142
                     /gene="Ago1"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(936..938,981..983,1023..1025,1035..1037,1089..1091,
                     1110..1112,1116..1118)
                     /gene="Ago1"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
     misc_feature    1275..>2279
                     /gene="Ago1"
                     /note="Piwi_ago-like: PIWI domain, Argonaute-like
                     subfamily. Argonaute is the central component of the
                     RNA-induced silencing complex (RISC) and related
                     complexes. The PIWI domain is the C-terminal portion of
                     Argonaute and consists of two subdomains, one of...;
                     Region: Piwi_ago-like; cd04657"
                     /db_xref="CDD:240015"
     misc_feature    order(1695..1697,1707..1709,1743..1754,1761..1763,
                     1785..1787,1794..1796,1806..1808,1818..1820)
                     /gene="Ago1"
                     /note="5' RNA guide strand anchoring site; other site"
                     /db_xref="CDD:240015"
ORIGIN      
gccgagcccggcccgggagcccaagcggcgagagtgcggggtccctaggcccctcacgctggactccacagtctctgggccgcctgacctctgcacgggtatatgggatggaagcgggaccctcgggagcagctgcgggcccctatctgccccccctgcagcaggtgttccaggcacctcgtcggcctggtattggcactgtggggaaacctatcaagctcctggccaattactttgaggtggacattcctaagatcgacgtctaccactacgaggtggacatcaagccggataagtgtccccgtcgagtcaaccgggaagtggtggaatacatggtccagcatttcaagcctcagatctttggtgatcgcaagcccgtgtatgatggaaagaagaacatttacactgtcaccgcactgcccattggcaatgagcgggtcgacttcgaggtgacaatccctggggaggggaaggatcgaatttttaaggtctccatcaagtggctagctattgtgagctggcgcatgttgcatgaggccctggtcagtggccagatccctgttcccctggagtctgtgcaagccctggatgtggccatgaggcacctggcatccatgaggtacacccctgtgggccgctccttcttctcaccgcctgagggctactaccacccgctggggggtgggcgcgaggtctggttcggctttcaccagtctgtgcgccctgccatgtggaagatgatgctcaacattgatgtctcagccactgccttctacaaggcacagccagtgattgagttcatgtgtgaggttctggacatcaggaacatcgatgaacagcccaagcctctcacggactcccagcgtgttcgctttaccaaggagatcaagggcctgaaggtggaagtgactcactgtggacagatgaagaggaaataccgcgtgtgtaatgttacccgccgccctgctagccatcagacgtttcctttacagctggagagtggacagactgtggagtgcacagtggcacaatatttcaagcagaaatataaccttcagctcaagtatccccaccttccctgcctccaagttggccaggaacaaaagcatacctacctgcctctagaggtctgtaatattgtagctgggcagcgctgcattaagaagttgactgacaaccagacttcaaccatgataaaggctacagctaggtcggctccagacagacaggaggagatcagccgcctgatgaagaatgccagctacaacctagatccctacatccaagaatttggaatcaaagtgaaggatgacatgacggaggtgacagggcgagtgctgccggcgcccatcttgcagtacggcggccgggtgagcaggaaccgggccattgccacacccaaccaaggtgtctgggacatgcgagggaaacagttctacaatgggattgagatcaaagtctgggccatcgcctgcttcgcaccacaaaaacagtgtcgagaagaggtgctcaagaacttcacagaccagctgcggaagatttccaaggatgcagggatgcccatccagggccagccttgtttctgcaaatatgcacagggagcagacagtgtggagcccatgttccggcatctcaagaacacctactcagggctgcaactcattatcgtcatcctgccggggaagacgccagtatatgctgaagtgaaacgtgttggagatacacttttgggaatggcaacacagtgtgtgcaggtgaagaatgtggtgaagacctctcctcagactctgtccaacctctgcctcaagatcaatgtcaaacttggcggcattaacaacatcctagtcccacaccagcgctctgctgtctttcaacagccagtgatattcctgggagcagatgttacacaccctccagcaggggatgggaaaaaaccttctattacagcagtagtaggcagtatggatgcccaccccagccgatattgtgccactgtgcgggtgcagcgaccacggcaggagatcattgaagacttgtcctacatggtgcgtgagctgctcatccagttctacaaatctacccgcttcaagcctacccgcatcatcttttatcgagatggggtccctgaaggccagctcccccagatcctccactatgaacttctggccattcgtgatgcctgcatcaaactggaaaaggactaccagcctgggatcacttatattgtggtgcagaaacgccatcacacccgccttttttgtgctgacaagaatgagcgactccttggcctataccctatatatagaccagctctcagagaagggaaagggaactaccatttattgaacttctcctatgtgccagacactgtacaaggcgtcttcctcacagcaaccctgtgagattgggaagagtggtaacatcccagctgggaccactgtggacaccaacatcactcacccttttgagt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]