GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-23 02:07:54, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_009321539            1248 bp    mRNA    linear   VRT 26-SEP-2014
DEFINITION  PREDICTED: Pygoscelis adeliae VCP-interacting membrane protein
            (VIMP), partial mRNA.
ACCESSION   XM_009321539
VERSION     XM_009321539.1
DBLINK      BioProject: PRJNA261076
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Pygoscelis adeliae (Adelie penguin)
  ORGANISM  Pygoscelis adeliae
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Aequornithes;
            Sphenisciformes; Spheniscidae; Pygoscelis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_008824499.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Pygoscelis adeliae Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..1248
                     /organism="Pygoscelis adeliae"
                     /mol_type="mRNA"
                     /isolate="BGI_AS28"
                     /db_xref="taxon:9238"
                     /chromosome="Unknown"
                     /sex="male"
                     /geo_loc_name="Antarctica"
     gene            <1..1248
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins, and 99% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 14 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:103914827"
     CDS             <1..495
                     /gene="VIMP"
                     /codon_start=1
                     /product="selenoprotein S"
                     /protein_id="XP_009319814.1"
                     /db_xref="GeneID:103914827"
                     /translation="
PVGSLLSSYGWYILLAAVAVYLLVQKISQSLAARPSSPPGAADAAVEPDMVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQQEVESGASTSSAVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"
     misc_feature    4..492
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
ORIGIN      
ccagtgggctccctgctgtccagctatggctggtacatcctcttggccgccgtcgccgtctatctcctcgtccagaagatatcccagagcctggcggccaggccgagcagcccgccgggagcagctgacgcagctgtggaacctgacatggtggtaagaaggcaggaagctttggcagcggctcgcctcaggatgcaagaggaattgaatgcacaagcagaaagatacaaagaaaaacagagacagcttgaagaagagaagcgaaggcagaagatagcaatgtgggaaagtatgcaagaaggaaaaagctataaaggaaacctgaaactgaatcagcaggaagtagaatctggtgcctccacctcatcagcagtcccgaagtctaaaccaaacaaaaagcccttgcgaggaggtggctataaccccctgtctggagaaggaggcggaacttgttcctggagaccaggccggagaggcccgtcagcaggtggatgaggctaacctccctagtgtctcatgtcactagcaggcttgatcttacccactgtctaactgcctacagattgcatgtcacagtgactccttggggactgggcttagtgcaggtgttaacttgaaaacaggtttacaccatttccaaatagtaacgcagaagctgatactacacaagaaaaatacctgatcctcttaggatgaagaaagaaacaatttcagtgtaatcagttaattttcacccttctgtagagaggaagtgtagtctccagccaaggtgaatcacctgggattgtgagatctgggttctgtggctggctattcaaaagactggcctcaggcaaatttaattatctaggctcagtttaccgctgtaaaatgaggatatttaccatcctcaggcatgcgttaccagatttactgtgtttggctggaaggtactttagaagggaggaatattgtcatcggcagataccttgaattatagaaggagggactttcagaaaaaacagatgaactgacaaacgccaggaatttgcaccacaggccagttattgtaaagagtctctgtgacaagctaccttgaatgatgttttccttataaatggtaaacaaaccagtgaggattactgatgctagacagcagatgggggggttcttgctattctttttttttttaatttcaactgctttgtaaaaacaaaatactgttaatattaaatacaattgcaaacaaatcataaatctagtatttac
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]