LOCUS       XM_008100877             840 bp    mRNA    linear   PLN 25-FEB-2022
DEFINITION  Colletotrichum graminicola M1.001 aminodeoxychorismate lyase
            (GLRG_10192), partial mRNA.
ACCESSION   XM_008100877
VERSION     XM_008100877.1
DBLINK      BioProject: PRJNA225514
            BioSample: SAMN02953757
KEYWORDS    RefSeq.
SOURCE      Colletotrichum graminicola M1.001
  ORGANISM  Colletotrichum graminicola M1.001
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae;
            Colletotrichum; Colletotrichum graminicola species complex.
REFERENCE   1  (bases 1 to 840)
  AUTHORS   Vaillancourt,L., Ma,L.-J., Thon,M., Dickman,M., Young,S.K.,
            Zeng,Q., Koehrsen,M., Alvarado,L., Berlin,A., Borenstein,D.,
            Chen,Z., Engels,R., Freedman,E., Gellesch,M., Goldberg,J.,
            Griggs,A., Gujja,S., Heiman,D., Hepburn,T., Howarth,C., Jen,D.,
            Larson,L., Lewis,B., Mehta,T., Park,D., Pearson,M., Roberts,A.,
            Saif,S., Shea,T., Shenoy,N., Sisk,P., Stolte,C., Sykes,S., Walk,T.,
            White,J., Yandava,C., Haas,B., Galagan,J., Nusbaum,C. and Birren,B.
  CONSRTM   The Broad Institute Genome Sequencing Platform
  TITLE     The Genome Sequence of Glomerella graminicola strain M1.001
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 840)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-FEB-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 840)
  AUTHORS   Vaillancourt,L., Ma,L.-J., Thon,M., Dickman,M., Young,S.K.,
            Zeng,Q., Koehrsen,M., Alvarado,L., Berlin,A., Borenstein,D.,
            Chen,Z., Engels,R., Freedman,E., Gellesch,M., Goldberg,J.,
            Griggs,A., Gujja,S., Heiman,D., Hepburn,T., Howarth,C., Jen,D.,
            Larson,L., Lewis,B., Mehta,T., Park,D., Pearson,M., Roberts,A.,
            Saif,S., Shea,T., Shenoy,N., Sisk,P., Stolte,C., Sykes,S., Walk,T.,
            White,J., Yandava,C., Haas,B., Galagan,J., Nusbaum,C. and Birren,B.
  CONSRTM   The Broad Institute Genome Sequencing Platform
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUN-2009) Broad Institute of MIT and Harvard, 7
            Cambridge Center, Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_007361061).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..840
                     /organism="Colletotrichum graminicola M1.001"
                     /mol_type="mRNA"
                     /strain="M1.001"
                     /type_material="culture from epitype of Colletotrichum
                     graminicola"
                     /db_xref="taxon:645133"
                     /chromosome="Unknown"
     gene            <1..>840
                     /locus_tag="GLRG_10192"
                     /db_xref="GeneID:24415557"
     CDS             1..840
                     /locus_tag="GLRG_10192"
                     /codon_start=1
                     /product="aminodeoxychorismate lyase"
                     /protein_id="XP_008099068.1"
                     /db_xref="GeneID:24415557"
                     /translation="

MPNEDFQLFTSLRYDPELLTVPKRHLDNAGWNARMTSSFYMLDLHRDRMLRAATYWNWTPAIETLRGAAGLQRLTEAIESFLAQHGKESALRVKVILTSEGSLSCEASSVPAVPLGNLFPQRLPSPGSSRQAGDPSQDSPMEVVIDKTETPQSEYTHYKTTKRAMYDTARDRESIALTDRKEVLLVNSKSGNIMEGSLTTPFFWRNGRWVTPPVSTEYIPENGSGGQDGTTRRWALERCLAVEEEVTAGSVVDGEPCWLSNGVRGFTFGKVQLNPTKKN"

     misc_feature    118..801
                     /locus_tag="GLRG_10192"
                     /note="PyridoxaL 5'-Phosphate Dependent Enzymes class IV
                     (PLPDE_IV). This D-amino acid superfamily, one of five
                     classes of PLPDE, consists of branched-chain amino acid
                     aminotransferases (BCAT), D-amino acid transferases
                     (DAAT), and 4-amino-4-deoxychorismate...; Region:
                     PLPDE_IV; cl00224"
                     /db_xref="CDD:444764"
     misc_feature    order(142..144,475..477,583..585,688..693,784..786)
                     /locus_tag="GLRG_10192"
                     /note="substrate-cofactor binding pocket [active]"
                     /db_xref="CDD:238254"
     misc_feature    order(142..144,475..477,583..585)
                     /locus_tag="GLRG_10192"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238254"
     misc_feature    475..477
                     /locus_tag="GLRG_10192"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238254"
ORIGIN      

atgcctaacgaagacttccagctattcacgtctctgcgatatgacccagagcttctcactgtacccaagagacacctcgacaatgcggggtggaacgccagaatgacctcctccttttacatgctggatcttcaccgggatcggatgctgcgagctgccacttactggaattggacccctgccattgagactctccggggcgcggccggtctccaaaggctaactgaggcgattgagtctttcttggcccagcacgggaaggaaagtgctctgagagtcaaggtcatactgacctcggaagggagtctcagctgcgaagcatcaagcgttcccgcggttcctctggggaaccttttcccgcagcggctcccgtcgccgggaagttcccggcaggctggagatccgtcacaggattcccccatggaggtggtgattgacaaaacggagactccacaatcagagtacacccactacaagacaacaaagcgggccatgtatgacaccgcgcgagaccgcgagagtatcgccctaacagatcgcaaggaagtgctcctcgtcaactcgaagagtggcaacatcatggagggcagcttgaccactccattcttctggagaaatggccggtgggtcactccaccggtatctaccgaatacatcccggagaatggcagcggcgggcaagacgggaccacccgcagatgggcccttgaacgctgtctggctgtggaggaggaggtcacagccggcagcgttgtggatggagagccatgctggctcagcaatggtgtccgcggtttcacctttggaaaggtccagcttaaccctaccaaaaaaaattga

//