GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-20 05:37:33, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_007679931             501 bp    mRNA    linear   PLN 03-FEB-2020
DEFINITION  Baudoinia panamericana UAMH 10762 uncharacterized protein
            (BAUCODRAFT_45698), partial mRNA.
ACCESSION   XM_007679931
VERSION     XM_007679931.1
DBLINK      BioProject: PRJNA245120
            BioSample: SAMN02981283
KEYWORDS    RefSeq.
SOURCE      Baudoinia panamericana UAMH 10762
  ORGANISM  Baudoinia panamericana UAMH 10762
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Dothideomycetes; Dothideomycetidae; Mycosphaerellales;
            Teratosphaeriaceae; Baudoinia.
REFERENCE   1  (bases 1 to 501)
  AUTHORS   Ohm,R.A., Feau,N., Henrissat,B., Schoch,C.L., Horwitz,B.A.,
            Barry,K.W., Condon,B.J., Copeland,A.C., Dhillon,B., Glaser,F.,
            Hesse,C.N., Kosti,I., LaButti,K., Lindquist,E.A., Lucas,S.,
            Salamov,A.A., Bradshaw,R.E., Ciuffetti,L., Hamelin,R.C., Kema,G.H.,
            Lawrence,C., Scott,J.A., Spatafora,J.W., Turgeon,B.G., de Wit,P.J.,
            Zhong,S., Goodwin,S.B. and Grigoriev,I.V.
  TITLE     Diverse lifestyles and strategies of plant pathogenesis encoded in
            the genomes of eighteen Dothideomycetes fungi
  JOURNAL   PLoS Pathog. 8 (12), E1003037 (2012)
   PUBMED   23236275
REFERENCE   2  (bases 1 to 501)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 501)
  AUTHORS   Ohm,R.A., Barry,K.W., Copeland,A.C., LaButti,K., Lindquist,E.A.,
            Lucas,S., Salamov,A.A., Feau,N., Henrissat,B., Schoch,C.L.,
            Horwitz,B.A., Condon,B.J., Dhillon,B., Glaser,F., Hesse,C.N.,
            Kosti,I., Bradshaw,R.E., Ciuffetti,L., Hamelin,R.C., Kema,G.H.,
            Lawrence,C., Scott,J.A., Spatafora,J.W., Turgeon,B.G., de
            Wit,P.J.G.M., Zhong,S., Goodwin,S.B. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (22-MAY-2012) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_006911265).
            
            ##Metadata-START##
            Organism Display Name :: Baudoinia panamericana UAMH 10762
            GOLD Stamp ID         :: Gi13901
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..501
                     /organism="Baudoinia panamericana UAMH 10762"
                     /mol_type="mRNA"
                     /strain="UAMH 10762"
                     /type_material="holotype of Baudoinia panamericana"
                     /db_xref="taxon:717646"
                     /chromosome="Unknown"
     gene            <1..>501
                     /locus_tag="BAUCODRAFT_45698"
                     /db_xref="GeneID:19114520"
     CDS             <1..>501
                     /locus_tag="BAUCODRAFT_45698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_007678121.1"
                     /db_xref="GeneID:19114520"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Bauco1_45698"
                     /translation="
LYDREISECYDLVSITSQADYEASVQGWHPTRKQREMKDKDMRYLLVRTVSSKEDVGIDLDTTVDGFLSFMLTHDSTPAVPVLYIYELHLAGQLRKLGLGSHLLSLAENIAERVGVKKVMLTCFLSNTKAHTFYLKHGYAKDVSSPDDRRTRNGISKPDYVIMSKTV"
ORIGIN      
ctgtacgacagggaaatatcggaatgctacgaccttgtctccatcacgagccaagcagactacgaagccagcgtccagggctggcatcccacgcgcaaacagcgcgagatgaaggacaaagatatgcgctacctccttgttcgaacagtttcctctaaggaagacgtcggcattgacctcgacaccacagttgatggatttctaagcttcatgctaacccacgactctactccagcagtaccagtgctatacatctatgagcttcatcttgcaggacagcttcgcaagctaggcctcggatcgcatttgctgagcttagcggagaacatcgcggaaagagttggcgtgaagaaggtcatgttgacctgcttcctcagtaacacgaaagcgcataccttctatctcaagcacgggtacgcgaaggatgtctcgtctccagacgaccggcggacgaggaacggaatctcgaagcccgattacgttatcatgagtaagacggtt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]