2024-04-20 05:37:33, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_007679931 501 bp mRNA linear PLN 03-FEB-2020 DEFINITION Baudoinia panamericana UAMH 10762 uncharacterized protein (BAUCODRAFT_45698), partial mRNA. ACCESSION XM_007679931 VERSION XM_007679931.1 DBLINK BioProject: PRJNA245120 BioSample: SAMN02981283 KEYWORDS RefSeq. SOURCE Baudoinia panamericana UAMH 10762 ORGANISM Baudoinia panamericana UAMH 10762 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Dothideomycetes; Dothideomycetidae; Mycosphaerellales; Teratosphaeriaceae; Baudoinia. REFERENCE 1 (bases 1 to 501) AUTHORS Ohm,R.A., Feau,N., Henrissat,B., Schoch,C.L., Horwitz,B.A., Barry,K.W., Condon,B.J., Copeland,A.C., Dhillon,B., Glaser,F., Hesse,C.N., Kosti,I., LaButti,K., Lindquist,E.A., Lucas,S., Salamov,A.A., Bradshaw,R.E., Ciuffetti,L., Hamelin,R.C., Kema,G.H., Lawrence,C., Scott,J.A., Spatafora,J.W., Turgeon,B.G., de Wit,P.J., Zhong,S., Goodwin,S.B. and Grigoriev,I.V. TITLE Diverse lifestyles and strategies of plant pathogenesis encoded in the genomes of eighteen Dothideomycetes fungi JOURNAL PLoS Pathog. 8 (12), E1003037 (2012) PUBMED 23236275 REFERENCE 2 (bases 1 to 501) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (03-FEB-2020) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 501) AUTHORS Ohm,R.A., Barry,K.W., Copeland,A.C., LaButti,K., Lindquist,E.A., Lucas,S., Salamov,A.A., Feau,N., Henrissat,B., Schoch,C.L., Horwitz,B.A., Condon,B.J., Dhillon,B., Glaser,F., Hesse,C.N., Kosti,I., Bradshaw,R.E., Ciuffetti,L., Hamelin,R.C., Kema,G.H., Lawrence,C., Scott,J.A., Spatafora,J.W., Turgeon,B.G., de Wit,P.J.G.M., Zhong,S., Goodwin,S.B. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (22-MAY-2012) US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_006911265). ##Metadata-START## Organism Display Name :: Baudoinia panamericana UAMH 10762 GOLD Stamp ID :: Gi13901 ##Metadata-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..501 /organism="Baudoinia panamericana UAMH 10762" /mol_type="mRNA" /strain="UAMH 10762" /type_material="holotype of Baudoinia panamericana" /db_xref="taxon:717646" /chromosome="Unknown" gene <1..>501 /locus_tag="BAUCODRAFT_45698" /db_xref="GeneID:19114520" CDS <1..>501 /locus_tag="BAUCODRAFT_45698" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_007678121.1" /db_xref="GeneID:19114520" /db_xref="InterPro:IPR000182" /db_xref="JGIDB:Bauco1_45698" /translation="
LYDREISECYDLVSITSQADYEASVQGWHPTRKQREMKDKDMRYLLVRTVSSKEDVGIDLDTTVDGFLSFMLTHDSTPAVPVLYIYELHLAGQLRKLGLGSHLLSLAENIAERVGVKKVMLTCFLSNTKAHTFYLKHGYAKDVSSPDDRRTRNGISKPDYVIMSKTV"
ORIGIN
ctgtacgacagggaaatatcggaatgctacgaccttgtctccatcacgagccaagcagactacgaagccagcgtccagggctggcatcccacgcgcaaacagcgcgagatgaaggacaaagatatgcgctacctccttgttcgaacagtttcctctaaggaagacgtcggcattgacctcgacaccacagttgatggatttctaagcttcatgctaacccacgactctactccagcagtaccagtgctatacatctatgagcttcatcttgcaggacagcttcgcaagctaggcctcggatcgcatttgctgagcttagcggagaacatcgcggaaagagttggcgtgaagaaggtcatgttgacctgcttcctcagtaacacgaaagcgcataccttctatctcaagcacgggtacgcgaaggatgtctcgtctccagacgaccggcggacgaggaacggaatctcgaagcccgattacgttatcatgagtaagacggtt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]