2024-10-23 02:05:57, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_006957581 684 bp mRNA linear PLN 12-JUL-2017 DEFINITION Wallemia mellicola CBS 633.66 hypothetical protein mRNA. ACCESSION XM_006957581 VERSION XM_006957581.1 DBLINK BioProject: PRJNA225533 BioSample: SAMN02769629 KEYWORDS RefSeq. SOURCE Wallemia mellicola CBS 633.66 ORGANISM Wallemia mellicola CBS 633.66 Eukaryota; Fungi; Dikarya; Basidiomycota; Wallemiomycotina; Wallemiomycetes; Wallemiales; Wallemiaceae; Wallemia. REFERENCE 1 (bases 1 to 684) AUTHORS Padamsee,M., Kumar,T.K., Riley,R., Binder,M., Boyd,A., Calvo,A.M., Furukawa,K., Hesse,C., Hohmann,S., James,T.Y., LaButti,K., Lapidus,A., Lindquist,E., Lucas,S., Miller,K., Shantappa,S., Grigoriev,I.V., Hibbett,D.S., McLaughlin,D.J., Spatafora,J.W. and Aime,M.C. TITLE The genome of the xerotolerant mold Wallemia sebi reveals adaptations to osmotic stress and suggests cryptic sexual reproduction JOURNAL Fungal Genet. Biol. 49 (3), 217-226 (2012) PUBMED 22326418 REFERENCE 2 (bases 1 to 684) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (12-JUL-2017) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 684) AUTHORS Riley,R., LaButti,K., Lapidus,A., Lindquist,E., Lucas,S., Padamsee,M., Kumar,T.K.A., Binder,M., Boyd,A., Calvo,A., Furukawa,K., Hesse,C., Hohmann,S., James,T., Miller,K., Shantappa,S., Hibbett,D., McLaughlin,D., Spatafora,J., Aime,M.C. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (22-AUG-2011) US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_006531963). ##Metadata-START## Organism Display Name :: Wallemia sebi CBS 633.66 GOLD Stamp ID :: Gi04865 Assembly Name :: Wallemia sebi v1.0 ##Metadata-END## FEATURES Location/Qualifiers source 1..684 /organism="Wallemia mellicola CBS 633.66" /mol_type="mRNA" /strain="CBS 633.66" /culture_collection="CBS:633.66" /type_material="culture from holotype of Wallemia mellicola" /db_xref="taxon:671144" /chromosome="Unknown" gene 1..684 /locus_tag="WALSEDRAFT_60048" /db_xref="GeneID:18473708" CDS 286..624 /locus_tag="WALSEDRAFT_60048" /note="hypothetical protein UM05520.1; expressed protein" /codon_start=1 /product="hypothetical protein" /protein_id="XP_006957643.1" /db_xref="GeneID:18473708" /db_xref="JGIDB:Walse1_60048" /translation="
MKKIKDELNRKAYLEMVGSSLFPQDEQKRKRKSVYKETKDELQVITSVLFSMVAVATAIWWAGGTMNPTYKTLLAMFGAIAIAIVETALYVIIQMRKSETGRDTEERKKKSQ"
misc_feature 286..558 /locus_tag="WALSEDRAFT_60048" /note="Endoplasmic reticulum-based factor for assembly of V-ATPase; Region: Vma12; pfam11712" /db_xref="CDD:463329" ORIGIN
gttgagctcgtggaaaagctaaataatgtagcaagaggaaatggagagtatagagaagttgatgtcagcacactaacacatgaagatattacatatattatcaagtttgtgagaaaacacagtcagacactccaagagaaaggaatagatacacgtcaatatagcgttgtgacgctccttgctggttctactaattcagataacgcaatacaatcgttcaaagtaggtaactggaggatatatgctcaattaacaccagaacagagcacggaatatgatgagaatatgaagaagatcaaagatgagctcaatagaaaggcttatcttgagatggtcggatcttctctatttcctcaagacgagcagaagcgcaagaggaagtctgtatacaaggagacgaaggatgagctacaagtaattacatcggtgttgtttagcatggtagctgtagcaactgctatatggtgggccggtggtacgatgaatccgacatataaaacattactggcgatgtttggtgctatcgcaattgcaatagtagagacagcgctgtatgtcataatacagatgcgcaaaagcgagactgggagggatacagaggagagaaaaaagaaatcacagtagaatgtatgaataaactgttgtatgaatattttatatcgtcaatcgatgatcatctgaccc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]