ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-11-01 17:15:15, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_006957581 684 bp mRNA linear PLN 12-JUL-2017
DEFINITION Wallemia mellicola CBS 633.66 hypothetical protein mRNA.
ACCESSION XM_006957581
VERSION XM_006957581.1
DBLINK BioProject: PRJNA225533
BioSample: SAMN02769629
KEYWORDS RefSeq.
SOURCE Wallemia mellicola CBS 633.66
ORGANISM Wallemia mellicola CBS 633.66
Eukaryota; Fungi; Dikarya; Basidiomycota; Wallemiomycotina;
Wallemiomycetes; Wallemiales; Wallemiaceae; Wallemia.
REFERENCE 1 (bases 1 to 684)
AUTHORS Padamsee,M., Kumar,T.K., Riley,R., Binder,M., Boyd,A., Calvo,A.M.,
Furukawa,K., Hesse,C., Hohmann,S., James,T.Y., LaButti,K.,
Lapidus,A., Lindquist,E., Lucas,S., Miller,K., Shantappa,S.,
Grigoriev,I.V., Hibbett,D.S., McLaughlin,D.J., Spatafora,J.W. and
Aime,M.C.
TITLE The genome of the xerotolerant mold Wallemia sebi reveals
adaptations to osmotic stress and suggests cryptic sexual
reproduction
JOURNAL Fungal Genet. Biol. 49 (3), 217-226 (2012)
PUBMED 22326418
REFERENCE 2 (bases 1 to 684)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (12-JUL-2017) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 684)
AUTHORS Riley,R., LaButti,K., Lapidus,A., Lindquist,E., Lucas,S.,
Padamsee,M., Kumar,T.K.A., Binder,M., Boyd,A., Calvo,A.,
Furukawa,K., Hesse,C., Hohmann,S., James,T., Miller,K.,
Shantappa,S., Hibbett,D., McLaughlin,D., Spatafora,J., Aime,M.C.
and Grigoriev,I.V.
CONSRTM US DOE Joint Genome Institute (JGI-PGF)
TITLE Direct Submission
JOURNAL Submitted (22-AUG-2011) US DOE Joint Genome Institute, 2800
Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_006531963).
##Metadata-START##
Organism Display Name :: Wallemia sebi CBS 633.66
GOLD Stamp ID :: Gi04865
Assembly Name :: Wallemia sebi v1.0
##Metadata-END##
FEATURES Location/Qualifiers
source 1..684
/organism="Wallemia mellicola CBS 633.66"
/mol_type="mRNA"
/strain="CBS 633.66"
/culture_collection="CBS:633.66"
/type_material="culture from holotype of Wallemia
mellicola"
/db_xref="taxon:671144"
/chromosome="Unknown"
gene 1..684
/locus_tag="WALSEDRAFT_60048"
/db_xref="GeneID:18473708"
CDS 286..624
/locus_tag="WALSEDRAFT_60048"
/note="hypothetical protein UM05520.1; expressed protein"
/codon_start=1
/product="hypothetical protein"
/protein_id="XP_006957643.1"
/db_xref="GeneID:18473708"
/db_xref="JGIDB:Walse1_60048"
/translation="
MKKIKDELNRKAYLEMVGSSLFPQDEQKRKRKSVYKETKDELQVITSVLFSMVAVATAIWWAGGTMNPTYKTLLAMFGAIAIAIVETALYVIIQMRKSETGRDTEERKKKSQ"
misc_feature 286..558
/locus_tag="WALSEDRAFT_60048"
/note="Endoplasmic reticulum-based factor for assembly of
V-ATPase; Region: Vma12; pfam11712"
/db_xref="CDD:463329"
ORIGIN
gttgagctcgtggaaaagctaaataatgtagcaagaggaaatggagagtatagagaagttgatgtcagcacactaacacatgaagatattacatatattatcaagtttgtgagaaaacacagtcagacactccaagagaaaggaatagatacacgtcaatatagcgttgtgacgctccttgctggttctactaattcagataacgcaatacaatcgttcaaagtaggtaactggaggatatatgctcaattaacaccagaacagagcacggaatatgatgagaatatgaagaagatcaaagatgagctcaatagaaaggcttatcttgagatggtcggatcttctctatttcctcaagacgagcagaagcgcaagaggaagtctgtatacaaggagacgaaggatgagctacaagtaattacatcggtgttgtttagcatggtagctgtagcaactgctatatggtgggccggtggtacgatgaatccgacatataaaacattactggcgatgtttggtgctatcgcaattgcaatagtagagacagcgctgtatgtcataatacagatgcgcaaaagcgagactgggagggatacagaggagagaaaaaagaaatcacagtagaatgtatgaataaactgttgtatgaatattttatatcgtcaatcgatgatcatctgaccc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]