2024-04-20 01:36:55, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_006690877 435 bp mRNA linear PLN 03-APR-2018 DEFINITION Chaetomium thermophilum var. thermophilum DSM 1495 hypothetical protein (CTHT_0003960), partial mRNA. ACCESSION XM_006690877 VERSION XM_006690877.1 DBLINK BioProject: PRJNA225505 BioSample: SAMN02981263 KEYWORDS RefSeq. SOURCE Thermochaetoides thermophila DSM 1495 ORGANISM Thermochaetoides thermophila DSM 1495 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae; Thermochaetoides. REFERENCE 1 (bases 1 to 435) AUTHORS Amlacher,S., Sarges,P., Flemming,D., van Noort,V., Kunze,R., Devos,D.P., Arumugam,M., Bork,P. and Hurt,E. TITLE Insight into structure and assembly of the nuclear pore complex by utilizing the genome of a eukaryotic thermophile JOURNAL Cell 146 (2), 277-289 (2011) PUBMED 21784248 REFERENCE 2 (bases 1 to 435) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (03-APR-2018) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 435) AUTHORS van Noort,V., Amlacher,S., Arumugam,M., Bradatsch,B., Bange,G., Creevey,C., Devos,D., Falk,S., Sinning,I., Bork,P. and Hurt,E. TITLE Direct Submission JOURNAL Submitted (06-JUN-2011) Structural and Computational Biology, European Molecular Biology Laboratory, Meyerhofstrasse 1, Heidelberg 69117, Germany COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_006383023). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..435 /organism="Thermochaetoides thermophila DSM 1495" /mol_type="mRNA" /strain="DSM 1495" /variety="thermophilum" /culture_collection="DSM:1495" /type_material="type material of Chaetomium thermophilum" /db_xref="taxon:759272" /chromosome="Unknown" gene <1..>435 /locus_tag="CTHT_0003960" /db_xref="GeneID:18254434" CDS 1..435 /locus_tag="CTHT_0003960" /inference="ab initio prediction:AUGUSTUS:2.1" /codon_start=1 /product="hypothetical protein" /protein_id="XP_006690940.1" /db_xref="GeneID:18254434" /translation="
MHLLINTIALASRKPGSPRQDIYQEFADLKRRGVGRLLEPVDVNVDDDKKNILFVTQVYPQPREEDLELIRAVTPSFSAAPTAGSVASSAGACAGVGLSFNEVILTSWLTLSQSLGCIPSLPVLLIREVPLPALPALPAWHAFC"
misc_feature <49..177 /locus_tag="CTHT_0003960" /note="calponin homology (CH) domain superfamily; Region: CH_SF; cl00030" /db_xref="CDD:444660" misc_feature order(49..51,55..60,67..72,76..78,112..114,115..120, 139..141,145..150,154..159,166..171) /locus_tag="CTHT_0003960" /note="actin binding site [polypeptide binding]; other site" /db_xref="CDD:409031" ORIGIN
atgcacttgttgatcaataccatcgcccttgctagtcgaaaacctggaagtcctagacaagacatctaccaagaatttgccgatctcaagcgcagaggagtcggaaggctccttgagcccgtcgacgtcaacgtcgatgacgacaaaaagaacatcctcttcgtcactcaggtctacccacagcccagggaggaggatcttgagctgattcgcgccgtcacccccagctttagtgccgcgcccacggctggttcggttgcttcctctgccggcgcttgcgccggcgtgggactctcgtttaatgaggtcatcttgacctcctggcttacgctttcgcaaagcttgggctgcattccatccctaccggtgctcctcattcgggaggtaccgctgccagcgctgccagcgcttcccgcctggcatgccttctgttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]