GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-20 01:36:55, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_006690877             435 bp    mRNA    linear   PLN 03-APR-2018
DEFINITION  Chaetomium thermophilum var. thermophilum DSM 1495 hypothetical
            protein (CTHT_0003960), partial mRNA.
ACCESSION   XM_006690877
VERSION     XM_006690877.1
DBLINK      BioProject: PRJNA225505
            BioSample: SAMN02981263
KEYWORDS    RefSeq.
SOURCE      Thermochaetoides thermophila DSM 1495
  ORGANISM  Thermochaetoides thermophila DSM 1495
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermochaetoides.
REFERENCE   1  (bases 1 to 435)
  AUTHORS   Amlacher,S., Sarges,P., Flemming,D., van Noort,V., Kunze,R.,
            Devos,D.P., Arumugam,M., Bork,P. and Hurt,E.
  TITLE     Insight into structure and assembly of the nuclear pore complex by
            utilizing the genome of a eukaryotic thermophile
  JOURNAL   Cell 146 (2), 277-289 (2011)
   PUBMED   21784248
REFERENCE   2  (bases 1 to 435)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 435)
  AUTHORS   van Noort,V., Amlacher,S., Arumugam,M., Bradatsch,B., Bange,G.,
            Creevey,C., Devos,D., Falk,S., Sinning,I., Bork,P. and Hurt,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2011) Structural and Computational Biology,
            European Molecular Biology Laboratory, Meyerhofstrasse 1,
            Heidelberg 69117, Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_006383023).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..435
                     /organism="Thermochaetoides thermophila DSM 1495"
                     /mol_type="mRNA"
                     /strain="DSM 1495"
                     /variety="thermophilum"
                     /culture_collection="DSM:1495"
                     /type_material="type material of Chaetomium thermophilum"
                     /db_xref="taxon:759272"
                     /chromosome="Unknown"
     gene            <1..>435
                     /locus_tag="CTHT_0003960"
                     /db_xref="GeneID:18254434"
     CDS             1..435
                     /locus_tag="CTHT_0003960"
                     /inference="ab initio prediction:AUGUSTUS:2.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_006690940.1"
                     /db_xref="GeneID:18254434"
                     /translation="
MHLLINTIALASRKPGSPRQDIYQEFADLKRRGVGRLLEPVDVNVDDDKKNILFVTQVYPQPREEDLELIRAVTPSFSAAPTAGSVASSAGACAGVGLSFNEVILTSWLTLSQSLGCIPSLPVLLIREVPLPALPALPAWHAFC"
     misc_feature    <49..177
                     /locus_tag="CTHT_0003960"
                     /note="calponin homology (CH) domain superfamily; Region:
                     CH_SF; cl00030"
                     /db_xref="CDD:444660"
     misc_feature    order(49..51,55..60,67..72,76..78,112..114,115..120,
                     139..141,145..150,154..159,166..171)
                     /locus_tag="CTHT_0003960"
                     /note="actin binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:409031"
ORIGIN      
atgcacttgttgatcaataccatcgcccttgctagtcgaaaacctggaagtcctagacaagacatctaccaagaatttgccgatctcaagcgcagaggagtcggaaggctccttgagcccgtcgacgtcaacgtcgatgacgacaaaaagaacatcctcttcgtcactcaggtctacccacagcccagggaggaggatcttgagctgattcgcgccgtcacccccagctttagtgccgcgcccacggctggttcggttgcttcctctgccggcgcttgcgccggcgtgggactctcgtttaatgaggtcatcttgacctcctggcttacgctttcgcaaagcttgggctgcattccatccctaccggtgctcctcattcgggaggtaccgctgccagcgctgccagcgcttcccgcctggcatgccttctgttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]