GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2022-01-26 17:53:57, GGRNA.v2 : RefSeq release 209 (Nov, 2021)

LOCUS       XM_006675794             841 bp    mRNA    linear   PLN 03-FEB-2020
DEFINITION  Batrachochytrium dendrobatidis JAM81 uncharacterized protein
            (BATDEDRAFT_36418), mRNA.
ACCESSION   XM_006675794
VERSION     XM_006675794.1
DBLINK      BioProject: PRJNA225502
            BioSample: SAMN02746048
KEYWORDS    RefSeq.
SOURCE      Batrachochytrium dendrobatidis JAM81
  ORGANISM  Batrachochytrium dendrobatidis JAM81
            Eukaryota; Fungi; Fungi incertae sedis; Chytridiomycota;
            Chytridiomycota incertae sedis; Chytridiomycetes; Rhizophydiales;
            Rhizophydiales incertae sedis; Batrachochytrium.
REFERENCE   1  (bases 1 to 841)
  AUTHORS   Kuo,A., Salamov,A., Schmutz,J., Lucas,S., Pitluck,S., Rosenblum,E.,
            Stajich,J., Eisen,M. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     The draft genome of Batrachochytrium dendrobatidis
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 841)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 841)
  AUTHORS   Kuo,A., Salamov,A., Schmutz,J., Lucas,S., Pitluck,S., Rosenblum,E.,
            Stajich,J., Eisen,M. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (01-DEC-2009) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_006281099).
            
            ##Metadata-START##
            Organism Display Name :: Batrachochytrium dendrobatidis JAM81
            GOLD Stamp ID         :: Gi01093
            Diseases              :: Chytridiomycosis
            Habitat               :: Fresh water
            Phenotypes            :: Chytrid, Non-filamentous, Pathogen
            ##Metadata-END##
FEATURES             Location/Qualifiers
     source          1..841
                     /organism="Batrachochytrium dendrobatidis JAM81"
                     /mol_type="mRNA"
                     /strain="JAM81"
                     /db_xref="taxon:684364"
                     /chromosome="Unknown"
     gene            1..841
                     /locus_tag="BATDEDRAFT_36418"
                     /db_xref="GeneID:18241079"
     CDS             25..726
                     /locus_tag="BATDEDRAFT_36418"
                     /note="similar to UPF0351 protein C9orf32 homolog;
                     expressed hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_006675857.1"
                     /db_xref="GeneID:18241079"
                     /db_xref="InterPro:IPR008576"
                     /db_xref="JGIDB:Batde5_36418"
                     /translation="
MIDTEEADVYINSRNEWYTDAASYWEQIEPTVQGMLGGFGFLTHIDAKGSSSFISEFVASDTDSPPRLDTKKACDCGAGIGRVSETFLLKTFDRVDLVEQNAQFLNTAKANFKENGLDNRVDAYIPLGLQEFSPEEGQYDLIWCQWVLGHLKDDDLVSFFQRCKKGLKPNGMIGVKENIAHQGILIDKEDSSMTRCEEILVEIMHRAGLTIVKQETQSGFPKELFAVKMFLLS"
     misc_feature    64..720
                     /locus_tag="BATDEDRAFT_36418"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:302624"
     misc_feature    order(250..270,319..324,400..408,457..459)
                     /locus_tag="BATDEDRAFT_36418"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
ORIGIN      
ccttgattgctcactattactactatgattgatacagaggaggctgatgtgtacatcaacagtcgtaatgaatggtacactgatgctgccagctactgggaacagatcgaacctacagtccaaggcatgctgggaggatttggatttctgactcatattgatgcaaaaggatcatcttcgtttatttccgagtttgtcgcttcagacactgactctccaccaaggctcgataccaagaaagcatgtgactgtggtgctggcattggtcgagtatcagaaacgtttttattaaagacatttgacagagtagacttggtggagcaaaatgcacagtttttaaatacagccaaagccaattttaaagaaaatggtttggacaatcgtgtggatgcatatatccctttaggactgcaggaattttctccagaggaaggtcaatatgacctgatttggtgtcagtgggtacttggacatcttaaagatgatgatctagtaagtttttttcagcgatgcaaaaagggtctcaagccaaatggtatgattggtgttaaggaaaatattgcgcaccaaggcattctgattgacaaagaggacagcagtatgaccagatgtgaggagattcttgttgaaatcatgcatcgtgctggactcacgattgtcaagcaggaaacgcaatctggattcccaaaagaactgtttgctgttaaaatgtttctgctcagctaaacacgctattggatctcgtcaagtttgacttgagtttcttaccaccgtttgtccagtctaaatggtccggtggtatagcttagccagtagttttaaatgaaaatatactttagat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]