ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-23 11:14:08, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_005187320 600 bp mRNA linear INV 24-AUG-2023
DEFINITION PREDICTED: Musca domestica protein sisterless A-like
(LOC101890048), mRNA.
ACCESSION XM_005187320
VERSION XM_005187320.4
DBLINK BioProject: PRJNA1002374
KEYWORDS RefSeq; includes ab initio.
SOURCE Musca domestica (house fly)
ORGANISM Musca domestica
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
Muscomorpha; Muscoidea; Muscidae; Musca.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_026712238) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
On Aug 24, 2023 this sequence version replaced XM_005187320.3.
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_030504385.1-RS_2023_08
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.1
Annotation Method :: Best-placed RefSeq; Gnomon;
cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 08/18/2023
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 100% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..600
/organism="Musca domestica"
/mol_type="mRNA"
/strain="aabys"
/db_xref="taxon:7370"
/chromosome="Unknown"
/sex="female"
/tissue_type="Whole body"
/dev_stage="adult"
gene 1..600
/gene="LOC101890048"
/note="protein sisterless A-like; Derived by automated
computational analysis using gene prediction method:
Gnomon. Supporting evidence includes similarity to: 12
Proteins"
/db_xref="GeneID:101890048"
CDS 1..600
/gene="LOC101890048"
/codon_start=1
/product="protein sisterless A-like"
/protein_id="XP_005187377.2"
/db_xref="GeneID:101890048"
/translation="
MEQYNSSRSTNLFLDPLYTSLTQELSLESLGPTTISSTQLNPQNIDQIVEMEMKRIQENIARKEAQYVEQMLVENPITFERRNNVTVLRKATSDSSLSPEQQRLQQQRADACRRSRYNNKVKKAKSKYRHKYISQKLQQSSQMLNCIKDLIAEAESHLLAQGLHKEKLHQLRSNYGIERPANIVRVDVNAVDFVLPTEP"
ORIGIN
atggaacaatataactccagccgctcaaccaatctcttcttggaccccctctacacatcgctgacacaagaattgtcattggaaagtttgggaccgacaacgatttcatcgacccaactaaatccgcaaaacatcgatcaaattgtcgaaatggaaatgaaacgcattcaggagaacatcgcccgtaaagaggcacagtatgtggaacaaatgttggtcgaaaatccaattacatttgaaagacgcaacaacgtcactgtgctaagaaaggcaacctcggacagctcattatcacccgaacaacaacggttgcagcagcaacgtgccgatgcatgtcgacgttctcgctacaacaacaaagtgaaaaaagccaagtcgaaatatcgccacaaatacatttcccagaaactccagcaaagcagtcagatgctgaattgtattaaggatctaattgccgaggctgaaagtcatttactcgcccaaggattgcacaaagagaagctgcatcaattgcgttcgaattatggcattgaaaggccagcaaatattgttcgtgttgacgtcaatgcagtagattttgttttgccaacggagccatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]