GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-15 04:32:22, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_005187320             600 bp    mRNA    linear   INV 24-AUG-2023
DEFINITION  PREDICTED: Musca domestica protein sisterless A-like
            (LOC101890048), mRNA.
ACCESSION   XM_005187320
VERSION     XM_005187320.4
DBLINK      BioProject: PRJNA1002374
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Musca domestica (house fly)
  ORGANISM  Musca domestica
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Musca.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_026712238) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Aug 24, 2023 this sequence version replaced XM_005187320.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030504385.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/18/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..600
                     /organism="Musca domestica"
                     /mol_type="mRNA"
                     /strain="aabys"
                     /db_xref="taxon:7370"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="Whole body"
                     /dev_stage="adult"
     gene            1..600
                     /gene="LOC101890048"
                     /note="protein sisterless A-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:101890048"
     CDS             1..600
                     /gene="LOC101890048"
                     /codon_start=1
                     /product="protein sisterless A-like"
                     /protein_id="XP_005187377.2"
                     /db_xref="GeneID:101890048"
                     /translation="
MEQYNSSRSTNLFLDPLYTSLTQELSLESLGPTTISSTQLNPQNIDQIVEMEMKRIQENIARKEAQYVEQMLVENPITFERRNNVTVLRKATSDSSLSPEQQRLQQQRADACRRSRYNNKVKKAKSKYRHKYISQKLQQSSQMLNCIKDLIAEAESHLLAQGLHKEKLHQLRSNYGIERPANIVRVDVNAVDFVLPTEP"
ORIGIN      
atggaacaatataactccagccgctcaaccaatctcttcttggaccccctctacacatcgctgacacaagaattgtcattggaaagtttgggaccgacaacgatttcatcgacccaactaaatccgcaaaacatcgatcaaattgtcgaaatggaaatgaaacgcattcaggagaacatcgcccgtaaagaggcacagtatgtggaacaaatgttggtcgaaaatccaattacatttgaaagacgcaacaacgtcactgtgctaagaaaggcaacctcggacagctcattatcacccgaacaacaacggttgcagcagcaacgtgccgatgcatgtcgacgttctcgctacaacaacaaagtgaaaaaagccaagtcgaaatatcgccacaaatacatttcccagaaactccagcaaagcagtcagatgctgaattgtattaaggatctaattgccgaggctgaaagtcatttactcgcccaaggattgcacaaagagaagctgcatcaattgcgttcgaattatggcattgaaaggccagcaaatattgttcgtgttgacgtcaatgcagtagattttgttttgccaacggagccatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]