2024-10-04 19:55:59, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS XM_005051731 1309 bp mRNA linear VRT 20-APR-2016 DEFINITION PREDICTED: Ficedula albicollis VCP interacting membrane selenoprotein (VIMP), mRNA. ACCESSION XM_005051731 VERSION XM_005051731.1 DBLINK BioProject: PRJNA208061 KEYWORDS RefSeq. SOURCE Ficedula albicollis (Collared flycatcher) ORGANISM Ficedula albicollis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Passeriformes; Muscicapidae; Ficedula. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_021682.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Ficedula albicollis Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1309 /organism="Ficedula albicollis" /mol_type="mRNA" /isolate="OC2" /db_xref="taxon:59894" /chromosome="10" /sex="male" /geo_loc_name="Sweden: Oland" /collection_date="2009" gene 1..1309 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns" /db_xref="GeneID:101816383" CDS 1..570 /gene="VIMP" /codon_start=1 /product="selenoprotein S" /protein_id="XP_005051788.1" /db_xref="GeneID:101816383" /translation="
MELGGAGPAAGPGPELGRGGLEALQHTVGSVLASYGWYMLLAAVAVYLLVQEVSRSLAARPSGRRGAAEAAEEPDVVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEERRRQKIAMWESMQEGKSYKGNLKLNQQEVESGASASTVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"
misc_feature 58..567 /gene="VIMP" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:462043" ORIGIN
atggagctcggcggcgcaggccccgcggcggggcccgggccggagctgggccggggcggcctggaggccctgcagcacacggtaggctcggtgctggccagctatggctggtacatgctcctggccgcggtcgccgtgtatctcctggtgcaggaggtgtcccgcagcctggcggcgcggccgagcggccggcgcggagcggctgaggcggcggaggagcctgatgtggtggtaagaaggcaggaagctttggcagcagctcgcctcaggatgcaagaggaattgaatgcacaagcagaaagatacaaagaaaagcaaagacagctggaggaggagaggcgaaggcagaagatcgccatgtgggagagtatgcaggaaggaaaaagctacaaaggaaacctgaaactgaatcagcaagaagtagaatctggtgcctccgcctcaacagtcccgaaatctaaaccaaacaaaaagcctttgagaggaggtggctataaccccctgtctggagaaggaggagggacgtgctcctggagacccggccggcggggcccgtcagcaggtggatgaggctaatgtccctagtgtcccctggcactagcagccttgatcctgccccctgtctgtctgcctgcagctggcctgtcacagggactcctttgcggctggtttagtgcacttggtaacttaaaacgtttttttttgtttgatttacactgtttccaaattgtaacgcattggcagatcctacaccagagaaacacctgatcctcttagagagggcaaagagagaagcaatttcagtattatcaattaattttcactcttctgtagaggggatgtagtcttcagccatggtgaatcatctgggattgtgagatctgggttctctggcaaatttagttatctatgttcactttacctctgtaagatgaagatatttaccatcctcagacttatcaccagatttaccttttatacagtcatttagagaggaagggtattatcattggcagataccttgaatgtaggcagagggactttcaggaaaagcacaggtgatctgacaaatgccacggatttgcactgaacaccagttattgctgaagagtctctgtgacaagccagcttgaatgatgttttccttataaatggtgaacaaaccagtgaggattactgatgctagacagcagacaggaggttcttgctattccttttttttcccttttttctttttttttaatttcaactgctttgtaaaaacaagacactattaatattaaatataactgcaaacatcataaatcta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]