GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-10-04 19:55:59, GGRNA.v2 : RefSeq release 225 (Jul, 2024)

LOCUS       XM_005051731            1309 bp    mRNA    linear   VRT 20-APR-2016
DEFINITION  PREDICTED: Ficedula albicollis VCP interacting membrane
            selenoprotein (VIMP), mRNA.
ACCESSION   XM_005051731
VERSION     XM_005051731.1
DBLINK      BioProject: PRJNA208061
KEYWORDS    RefSeq.
SOURCE      Ficedula albicollis (Collared flycatcher)
  ORGANISM  Ficedula albicollis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Passeriformes; Muscicapidae;
            Ficedula.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_021682.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Ficedula albicollis Annotation
                                           Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1309
                     /organism="Ficedula albicollis"
                     /mol_type="mRNA"
                     /isolate="OC2"
                     /db_xref="taxon:59894"
                     /chromosome="10"
                     /sex="male"
                     /geo_loc_name="Sweden: Oland"
                     /collection_date="2009"
     gene            1..1309
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 12 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:101816383"
     CDS             1..570
                     /gene="VIMP"
                     /codon_start=1
                     /product="selenoprotein S"
                     /protein_id="XP_005051788.1"
                     /db_xref="GeneID:101816383"
                     /translation="
MELGGAGPAAGPGPELGRGGLEALQHTVGSVLASYGWYMLLAAVAVYLLVQEVSRSLAARPSGRRGAAEAAEEPDVVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEERRRQKIAMWESMQEGKSYKGNLKLNQQEVESGASASTVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"
     misc_feature    58..567
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
ORIGIN      
atggagctcggcggcgcaggccccgcggcggggcccgggccggagctgggccggggcggcctggaggccctgcagcacacggtaggctcggtgctggccagctatggctggtacatgctcctggccgcggtcgccgtgtatctcctggtgcaggaggtgtcccgcagcctggcggcgcggccgagcggccggcgcggagcggctgaggcggcggaggagcctgatgtggtggtaagaaggcaggaagctttggcagcagctcgcctcaggatgcaagaggaattgaatgcacaagcagaaagatacaaagaaaagcaaagacagctggaggaggagaggcgaaggcagaagatcgccatgtgggagagtatgcaggaaggaaaaagctacaaaggaaacctgaaactgaatcagcaagaagtagaatctggtgcctccgcctcaacagtcccgaaatctaaaccaaacaaaaagcctttgagaggaggtggctataaccccctgtctggagaaggaggagggacgtgctcctggagacccggccggcggggcccgtcagcaggtggatgaggctaatgtccctagtgtcccctggcactagcagccttgatcctgccccctgtctgtctgcctgcagctggcctgtcacagggactcctttgcggctggtttagtgcacttggtaacttaaaacgtttttttttgtttgatttacactgtttccaaattgtaacgcattggcagatcctacaccagagaaacacctgatcctcttagagagggcaaagagagaagcaatttcagtattatcaattaattttcactcttctgtagaggggatgtagtcttcagccatggtgaatcatctgggattgtgagatctgggttctctggcaaatttagttatctatgttcactttacctctgtaagatgaagatatttaccatcctcagacttatcaccagatttaccttttatacagtcatttagagaggaagggtattatcattggcagataccttgaatgtaggcagagggactttcaggaaaagcacaggtgatctgacaaatgccacggatttgcactgaacaccagttattgctgaagagtctctgtgacaagccagcttgaatgatgttttccttataaatggtgaacaaaccagtgaggattactgatgctagacagcagacaggaggttcttgctattccttttttttcccttttttctttttttttaatttcaactgctttgtaaaaacaagacactattaatattaaatataactgcaaacatcataaatcta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]