GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-15 04:25:38, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_003843560             429 bp    mRNA    linear   PLN 28-AUG-2017
DEFINITION  Leptosphaeria maculans JN3 hypothetical protein (LEMA_P077180.1),
            partial mRNA.
ACCESSION   XM_003843560
VERSION     XM_003843560.1
DBLINK      BioProject: PRJNA171003
KEYWORDS    RefSeq.
SOURCE      Plenodomus lingam JN3
  ORGANISM  Plenodomus lingam JN3
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporineae;
            Leptosphaeriaceae; Plenodomus; Plenodomus lingam/Leptosphaeria
            maculans species complex.
REFERENCE   1  (bases 1 to 429)
  AUTHORS   Rouxel,T., Grandaubert,J., Hane,J.K., Hoede,C., van de Wouw,A.P.,
            Couloux,A., Dominguez,V., Anthouard,V., Bally,P., Bourras,S.,
            Cozijnsen,A.J., Ciuffetti,L.M., Degrave,A., Dilmaghani,A.,
            Duret,L., Fudal,I., Goodwin,S.B., Gout,L., Glaser,N., Linglin,J.,
            Kema,G.H., Lapalu,N., Lawrence,C.B., May,K., Meyer,M., Ollivier,B.,
            Poulain,J., Schoch,C.L., Simon,A., Spatafora,J.W., Stachowiak,A.,
            Turgeon,B.G., Tyler,B.M., Vincent,D., Weissenbach,J., Amselem,J.,
            Quesneville,H., Oliver,R.P., Wincker,P., Balesdent,M.H. and
            Howlett,B.J.
  TITLE     Effector diversification within compartments of the Leptosphaeria
            maculans genome affected by Repeat-Induced Point mutations
  JOURNAL   Nat Commun 2, 202 (2011)
   PUBMED   21326234
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 429)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 429)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2010) to the INSDC. Genoscope - Centre National
            de Sequencage : BP 191 91006 EVRY cedex -FRANCE (E-mail :
            seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_003533876).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..429
                     /organism="Plenodomus lingam JN3"
                     /mol_type="mRNA"
                     /isolate="v23.1.3"
                     /db_xref="taxon:985895"
                     /chromosome="Unknown"
     gene            <1..>429
                     /locus_tag="LEMA_P077180.1"
                     /db_xref="GeneID:13292782"
     CDS             1..429
                     /locus_tag="LEMA_P077180.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003843608.1"
                     /db_xref="GeneID:13292782"
                     /db_xref="UniProtKB/TrEMBL:E5A934"
                     /translation="
MRYSLTLMGLATLGFHILPSLSAAVPASNLALRSNTIDKRHVYTVDEDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELA"
ORIGIN      
atgcgttactctctcactctgatgggcctggccaccctcggcttccacatcctccccagtctttccgcagctgtgcctgcctctaacttggctctccgctctaacacgattgacaagcgtcatgtatacactgtcgacgaggatgagcttgccaagcgtcatgtatacggtgtcgacaaggacgagcttgctaagcgtcatgtctacggtgtcgacaaggatgagcttgctaagcgtcatgtctacggtgtcgacaaggatgagcttgccaagcgtcatgtctacggtgtcgacaaggacgagcttgccaagcgtcatgtctacggtgtcgacaaggatgagcttgccaagcgtcatgtctacggtgtcgacaaagatgagcttgccaagcgtcatgtctacggtgtcgacaaggatgagcttgcatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]