GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-19 08:50:26, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_003676917             531 bp    mRNA    linear   PLN 04-DEC-2024
DEFINITION  Naumovozyma castellii uncharacterized protein (NCAS0F01260),
            partial mRNA.
ACCESSION   XM_003676917
VERSION     XM_003676917.1
DBLINK      BioProject: PRJNA79343
            BioSample: SAMEA2271985
KEYWORDS    RefSeq.
SOURCE      Naumovozyma castellii
  ORGANISM  Naumovozyma castellii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Naumovozyma.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 531)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 531)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUL-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_016496).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..531
                     /organism="Naumovozyma castellii"
                     /mol_type="mRNA"
                     /strain="type strain:CBS 4309"
                     /db_xref="taxon:27288"
                     /chromosome="6"
     gene            <1..>531
                     /gene="NCAS0F01260"
                     /locus_tag="NCAS_0F01260"
                     /db_xref="GeneID:96904258"
     CDS             1..531
                     /gene="NCAS0F01260"
                     /locus_tag="NCAS_0F01260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003676965.1"
                     /db_xref="GeneID:96904258"
                     /db_xref="UniProtKB/TrEMBL:G0VGI9"
                     /translation="
MGWHAQTNTLYAGSVNLYGGQVYLWQGDIPSTSMSNKSCNRRSCMFPKRANACIRKLKREMILRQSQRVNKGTLVNSQYSRKRLVNLFLFSKDQVRVSCGTFSKKKPLLQRASTPPQLFFHNCVHTCSISLRRRTYSVQFGQLVTDTTKTMFSLGLSHPGFSLLQIILYPFLSAVS"
ORIGIN      
atgggctggcatgctcaaaccaacaccttgtatgctggtagtgtaaatctttacgggggacaagtgtacctttggcaaggtgacataccttccacatccatgtcaaacaaaagctgtaaccgccgatcgtgtatgtttcccaaaagggcaaatgcctgcatacgtaagctgaaacgggaaatgattctcagacaatcacagcgcgtaaacaaaggcacgctagtgaatagccaatatagtcgcaaaagactagtcaatctcttcttgttctcgaaggatcaggtcagggtttcttgtggcacattctctaaaaagaaacctcttcttcagcgtgccagcaccccccctcaacttttttttcacaattgcgtacatacgtgtagtatttctctaagaagaagaacatactcagtacaatttggacagctcgttaccgatactaccaaaactatgttctctttgggtttatcgcaccctggattctcgcttttacagattatactgtatccttttctttcggcggttagctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]