LOCUS       XM_003654946             977 bp    mRNA    linear   PLN 29-NOV-2019
DEFINITION  Thermothielavioides terrestris NRRL 8126 uncharacterized protein
            (THITE_2118256), mRNA.
ACCESSION   XM_003654946
VERSION     XM_003654946.1
DBLINK      BioProject: PRJNA79337
            BioSample: SAMN02744067
KEYWORDS    RefSeq.
SOURCE      Thermothielavioides terrestris NRRL 8126
  ORGANISM  Thermothielavioides terrestris NRRL 8126
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothielavioides; Thermothielavioides terrestris.
REFERENCE   1  (bases 1 to 977)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 977)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.-C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.H.,
            Baker,S.E., Magnuson,J., LaBoissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 977)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 977)
  AUTHORS   Otillar,R., Salamov,A., Grimwood,J., Reid,I., Ishmael,N., John,T.,
            Darmond,C., Moisan,M.-C., Henrissat,B., Coutinho,P.M., Lombard,V.,
            Natvig,D., Lindquist,E., Schmutz,J., Lucas,S., Harris,P.,
            Powlowski,J., Bellemare,A., Taylor,D., Butler,G., de Vries,R.P.,
            Allijn,I.E., van den Brink,J., Ushinsky,S., Storms,R., Powell,A.J.,
            Paulsen,I.T., Elbourne,L.D.H., Baker,S.E., Magnuson,J.,
            LaBoissiere,S., Clutterbuck,A.J., Martinez,D., Wogulis,M., de
            Leon,A.L., Rey,M.W., Tsang,A., Berka,R.M. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_016460).
            
            ##Metadata-START##
            Organism Display Name :: Thielavia terrestris NRRL 8126
            GOLD Stamp ID         :: Gi01746
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Thielavia terrestris V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 10.15x
            ##Metadata-END##
FEATURES             Location/Qualifiers
     source          1..977
                     /organism="Thermothielavioides terrestris NRRL 8126"
                     /mol_type="mRNA"
                     /strain="NRRL 8126"
                     /db_xref="taxon:578455"
                     /chromosome="4"
     gene            1..977
                     /locus_tag="THITE_2118256"
                     /db_xref="GeneID:11524225"
     CDS             281..721
                     /locus_tag="THITE_2118256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654994.1"
                     /db_xref="GeneID:11524225"
                     /db_xref="JGIDB:Thite2_2118256"
                     /translation="

MQLKNLAFVAPLLLAIAHSAPTQTGEIAKKGELVKDADEIWLWKKDELQKDADAIWLWKKDELTKDADEIWLWKRGELKAKLQKDADEIWLWKKDELAKDSDEIWLWKKGELKGKLQKDADEIWLWKKDQLGSKKLVKDADEIWLW"

     misc_feature    <356..>709
                     /locus_tag="THITE_2118256"
                     /note="MAEBL; Provisional; Region: PTZ00121"
                     /db_xref="CDD:173412"
ORIGIN      

cagttgtggtgctgactgagatgcgcctcgggttcctgaaacctgctagcagaactcggttcggacttcgataggaaatcctgccagaagaggaaggtcggcaacaacaacactgcccagagaacacatgcggaggggcttgacgatgtccgcgacttccgagcataaatgtttaagggcctgagtgacggtcgcctgtgcctgctcgtctcccgaagccgagcacggcgcttcgaatctcctacagctcgctcctcgaatcttcccttacttgaacatcatgcagctcaagaacctggccttcgtggcccccttgctgctcgcgatcgcccacagcgcgcccacgcagacaggcgagatcgccaagaagggcgagctcgtaaaggacgccgacgagatctggctctggaagaaagacgagctgcagaaggacgctgacgccatctggctgtggaagaaggacgagctgaccaaggacgcggacgagatctggctgtggaagaggggcgagctgaaggccaagctgcagaaggatgccgacgagatctggttgtggaagaaggacgagctggcgaaagactcggacgagatttggctctggaagaagggcgagctgaaaggcaagttgcagaaggacgcggacgagatctggctgtggaagaaggaccagttgggctcgaagaagctcgtcaaggatgccgacgagatttggctttggtagccgcgtatccaaatcaggcatgccgctgatgggaactttactgcggcgcagtgctgttggcattgaaaaggctaagctatgaaagatccggctcatatgcaaccgtcgtacccgcccagaaaggcgtcgcttcgaatcgaactgcctcgctcgcagggtcgtaccgccccggcacatatacccatggccggccttgctctcctctggcattatctcgcatgcatcacgatgcttaagtgatggcgaggcagacacg

//