GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-03 11:17:49, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_003644656             303 bp    mRNA    linear   PLN 04-DEC-2024
DEFINITION  Eremothecium cymbalariae DBVPG#7215 60S ribosomal protein eL36
            (Ecym_2135), partial mRNA.
ACCESSION   XM_003644656
VERSION     XM_003644656.1
DBLINK      BioProject: PRJNA78153
            BioSample: SAMN03081426
KEYWORDS    RefSeq.
SOURCE      Eremothecium cymbalariae DBVPG#7215
  ORGANISM  Eremothecium cymbalariae DBVPG#7215
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Eremothecium.
REFERENCE   1  (bases 1 to 303)
  AUTHORS   Wendland,J. and Walther,A.
  TITLE     Genome evolution in the eremothecium clade of the Saccharomyces
            complex revealed by comparative genomics
  JOURNAL   G3 (Bethesda) 1 (7), 539-548 (2011)
   PUBMED   22384365
REFERENCE   2  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 303)
  AUTHORS   Wendland,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-FEB-2011) Yeast Biology, Carlsberg Laboratory, Gamle
            Carlsberg Vej 10, Copenhagen V DK-1899, Denmark
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_016450).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Eremothecium cymbalariae DBVPG#7215"
                     /mol_type="mRNA"
                     /strain="DBVPG#7215"
                     /db_xref="taxon:931890"
                     /chromosome="2"
     gene            <1..>303
                     /locus_tag="Ecym_2135"
                     /db_xref="GeneID:11471800"
     CDS             1..303
                     /locus_tag="Ecym_2135"
                     /note="similar to Ashbya gossypii AFL163C 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein eL36"
                     /protein_id="XP_003644704.1"
                     /db_xref="GeneID:11471800"
                     /translation="
MAVKSGIAVGLNKGKKVNSMTPAPKISYRKGASSKRTEFVRSIVKEVAGLAPYERRLLDLIRNSGEKRARKVAKKRLGTFGRAKAKVEEMNNVIAASRRH"
     misc_feature    10..297
                     /locus_tag="Ecym_2135"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      
atggctgttaaatctggtattgctgttggtttgaacaagggtaagaaggtcaactcgatgaccccagccccaaagatctcttacagaaagggtgcttcttccaagagaacggagtttgttagatctattgtcaaggaagtcgccgggttggctccatacgagagaagattgcttgatttgatcagaaactctggtgagaagagagccagaaaggttgccaagaagagattgggtacttttggcagagcaaaggctaaggttgaagaaatgaacaacgtcattgctgcttccagacgtcactga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]