GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 05:08:40, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       XM_003509997             747 bp    mRNA    linear   ROD 18-DEC-2018
DEFINITION  PREDICTED: Cricetulus griseus claudin-34 (Claudin-18), mRNA.
ACCESSION   XM_003509997
VERSION     XM_003509997.2
DBLINK      BioProject: PRJNA72741
KEYWORDS    RefSeq.
SOURCE      Cricetulus griseus (Chinese hamster)
  ORGANISM  Cricetulus griseus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
            Sciurognathi; Muroidea; Cricetidae; Cricetinae; Cricetulus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_003614803.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 18, 2018 this sequence version replaced XM_003509997.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Cricetulus griseus Annotation
                                           Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..747
                     /organism="Cricetulus griseus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10029"
                     /chromosome="Unknown"
                     /cell_line="CHO-K1"
     gene            1..747
                     /gene="Claudin-18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:100755597"
     CDS             13..651
                     /gene="Claudin-18"
                     /codon_start=1
                     /product="claudin-34"
                     /protein_id="XP_003510045.1"
                     /db_xref="GeneID:100755597"
                     /translation="
MLLLSRSANCQVGGFALASIAWILCSVSTGLPQWRVWYLNESLYSEPSVAFIGMWRVCIYRQTIKVNNARECHDYTYHDNFVPWNIRIVQHLLLGSNILGLFGTLATIFALRNVYTRKVPKNATYNPFIISAILNIVASTFVLLAVLCNYFSVIHKAGIAFPPYFHMPLYPPNQRIGIANVVASLAALMFLGTGIIFLSYTSPVETQVYPDV"
ORIGIN      
ttcgctgtcaccatgttgctgctcagcagaagtgccaactgtcaagttggcggatttgctttggcatccatagcatggatcctttgcagcgtctccacaggcctgccgcagtggcgagtgtggtacttgaatgaaagcctgtactctgagccttcggtagcctttataggaatgtggagagtttgcatttaccgccaaaccatcaaggtcaacaatgccagagagtgtcatgactacacctatcatgacaactttgttccttggaatattcgtatcgttcaacatctgttactgggctccaacattctcgggttatttgggacacttgccaccatttttgctcttcggaatgtgtacacacggaaagtacccaagaatgccacctacaatccgttcatcatttcggccattctcaacattgttgctagtaccttcgtcctccttgctgttttatgcaattatttctctgtcattcacaaagcaggaattgccttcccaccatatttccatatgcctttatatccacctaatcagagaattggaattgctaatgtagtggcaagtctagctgccctcatgtttttaggcactggcattattttcctttcgtacacttctcctgtggaaacccaagtatatcctgacgtttgaaaatttacttccagtttatatcaccttccaattcccagggattatagcaaggatgattttctgtttgtgtgtttgtctgtctccctcctttcctcc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]