GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-12-05 23:42:47, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       XM_003285195             381 bp    mRNA    linear   INV 27-APR-2011
DEFINITION  Dictyostelium purpureum hypothetical protein, mRNA.
ACCESSION   XM_003285195
VERSION     XM_003285195.1
KEYWORDS    RefSeq.
SOURCE      Dictyostelium purpureum
  ORGANISM  Dictyostelium purpureum
            Eukaryota; Amoebozoa; Evosea; Eumycetozoa; Dictyostelia;
            Dictyosteliales; Dictyosteliaceae; Dictyostelium.
REFERENCE   1  (bases 1 to 381)
  AUTHORS   Sucgang,R., Kuo,A., Tian,X., Salerno,W., Parikh,A., Feasley,C.L.,
            Dalin,E., Tu,H., Huang,E., Barry,K., Lindquist,E., Shapiro,H.,
            Bruce,D., Schmutz,J., Salamov,A., Fey,P., Gaudet,P., Anjard,C.,
            Mohan,M.B., Basu,S., Bushmanova,Y., van der Wel,H.,
            Katoh-Kurasawa,M., Coutinho,P.M., Saito,T., Elias,M., Schaap,P.,
            Kay,R.R., Henrissat,B., Eichinger,L., Rivero,F., Putnam,N.H.,
            West,C.M., Loomis,W.F., Chisholm,R.L., Shaulsky,G.,
            Strassmann,J.E., Queller,D.C., Kuspa,A. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Comparative genomics of the social amoebae Dictyostelium discoideum
            and Dictyostelium purpureum
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 381)
  AUTHORS   Kuo,A., Barry,K., Lindquist,E., Schmutz,J., Salamov,A., Pitluck,S.,
            Lucas,S., Sucgang,R., Kuspa,A. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (26-APR-2010) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_003519378).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..381
                     /organism="Dictyostelium purpureum"
                     /mol_type="mRNA"
                     /strain="QSDP1"
                     /db_xref="taxon:5786"
                     /chromosome="Unknown"
     gene            <1..>381
                     /locus_tag="DICPUDRAFT_22474"
                     /db_xref="GeneID:10502561"
     CDS             <1..>381
                     /locus_tag="DICPUDRAFT_22474"
                     /note="hypothetical protein DDBDRAFT_0204554"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003285243.1"
                     /db_xref="InterPro:IPR001383"
                     /db_xref="JGIDB:Dicpu1_22474"
                     /db_xref="GeneID:10502561"
                     /translation="
SFFNSLASLTTRAQVMKRAQRGLYGGKDILFGNILSFSNKKTRRDWKPNVHNKTYHSNLLGTDIRVRVTSYVIRCIDKAGSFDNYIVQTKDKDLQSELGSELKVAMKNVLKSKAIEILEQEAKQEQE"
     misc_feature    58..231
                     /locus_tag="DICPUDRAFT_22474"
                     /note="Ribosomal L28 family; Region: Ribosomal_L28;
                     pfam00830"
                     /db_xref="CDD:279203"
ORIGIN      
tcattcttcaactcattagcttcattaaccactagagctcaagttatgaaaagagctcaaagaggtttatacggtggaaaagatattctttttggaaatattttaagtttttcaaataaaaaaacaagaagagattggaaaccaaatgttcacaacaaaacttatcacagcaatcttttaggtacagatattagagttagagttacatcatatgttatcagatgtattgataaagcaggttcattcgataattatattgtacaaacaaaagataaagatttacaatcagaattaggttcagaattaaaagttgctatgaagaatgttttaaaaagtaaagcaattgaaattttagaacaagaagctaaacaagaacaagaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]