GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 08:04:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_003229462            1742 bp    mRNA    linear   VRT 31-MAY-2016
DEFINITION  PREDICTED: Anolis carolinensis VCP interacting membrane
            selenoprotein (vimp), mRNA.
ACCESSION   XM_003229462
VERSION     XM_003229462.3
DBLINK      BioProject: PRJNA60547
KEYWORDS    RefSeq.
SOURCE      Anolis carolinensis (green anole)
  ORGANISM  Anolis carolinensis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata;
            Toxicofera; Iguania; Dactyloidae; Anolis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_003339489.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 31, 2016 this sequence version replaced XM_003229462.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Anolis carolinensis Annotation
                                           Release 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1742
                     /organism="Anolis carolinensis"
                     /mol_type="mRNA"
                     /db_xref="taxon:28377"
                     /chromosome="Unknown"
                     /country="USA"
     gene            1..1742
                     /gene="vimp"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 14 ESTs, 5 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 22 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:100551705"
     CDS             63..611
                     /gene="vimp"
                     /codon_start=1
                     /product="selenoprotein S"
                     /protein_id="XP_003229510.1"
                     /db_xref="GeneID:100551705"
                     /translation="
MAADLRPGTPTEQEGAQVLQQTVVSLLSDYGWFILFSLIAVYLLVQKLSKTFRSTSKHSLDTTDIEPEAVVRQQEALLAARLRMQEELNAQAEKFKEKQKKLEEEKRKQKIAMWESMQEGKSYKENLRQNQEPQSGASTSTSVPKPKPRSKPLREGGYNPLSGDGGGTCSWRPGRRGPSSGG"
     misc_feature    90..608
                     /gene="vimp"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:429198"
ORIGIN      
tgacgtcccgctttctcattcgtgactcggcagcgggaggacccggatgtaggtgctgcaagatggcggcggatctgaggcctggtacgccgacggagcaggaaggcgctcaagtccttcagcaaaccgtggtttcattgctctcagactatggctggttcatcctcttcagtcttattgctgtttatttacttgtacaaaagctttccaaaacatttcgaagcaccagcaagcactccttggacacaacagatattgaacctgaggctgtggttagacaacaggaggctttgcttgctgcccgtctgagaatgcaagaagaactgaatgcacaagcagaaaaattcaaagaaaaacagaaaaagcttgaagaggagaaacgaaaacaaaagatcgccatgtgggaaagtatgcaggaaggcaaaagttacaaggagaatctcagacagaaccaggaacctcagtctggagcctcaacatcaaccagtgtcccaaagccaaaaccgagaagcaaacctttacgagaggggggttacaaccctctgtctggagacggtggcgggacctgctcatggagacccgggcgcagaggtccttcatcgggtggatgaggctagcttctgccagtgtcttctttgaacactggcagacactaatctggccccatagctgcagctgtctgtgggttgcttgacacagggacttagtggagggtagattagtactttagtgactcagagatatatgaaagaaaaaatgtaaatacagctgggagtgccatggaagcagcaggaagaaaatggtagaagcagaaagggaatgtcatgaggatgacttttctttttgagagcaaagcattgccatccatgcgttcccccaggttcttgtgtgcaatgggaacatccattgcataagagtttaggaccaaactccctgccaaagtgccttgggctctgcaggggacaaaacctgtttgaaatggcatgtttccctgctccaatttttgggggagtaagttttagatgccaaagctgggttttcctcacaatatccagcaaaggcagagcaagacaactggtagttgatccaatgtcactatttaaggccctgagaataagaagcattggaaatggtgctactttggatgttgagaccccaggtgtctcctgccaacagcttccaaactggctgagccacacactcatctggttggtaaatgtagccagttctcctttgaggtcatatcaaaagaatatttgagtttggttttggggttcaactcttcacaaagatggagcaatagatgcagcacattgagaaactccctgtaacaagcagcaacaaatgacgtggtccttataaatggtggacacatcactgaggacctccgaagataagacagctgattggggacagttcttgccctgccctcctcctgtttcatctgctttgtaagacaaaatactgtaaataacattagcagccttctttctttcggtggctcttttctatacaggaaagtacgtactcttgcttaatgaccatgtctcaagactgccatcctgtacacaggtaccgtggagtaagccatattggactgtgtgtgcttgcttctaggtaaacgtgtctgtgactgtgggtaaaacaggttgcatcattggtgtgtggcttgttccggacaaaaggcctcctcatactccatttcaaactgttgcttaataaattctatttctttagcatca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]