GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-21 06:56:46, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_002141116             372 bp    mRNA    linear   INV 06-DEC-2023
DEFINITION  Cryptosporidium muris RN66 prefoldin subunit 2, putative
            (CMU_014790), partial mRNA.
ACCESSION   XM_002141116
VERSION     XM_002141116.1
DBLINK      BioProject: PRJNA32283
            BioSample: SAMN02953683
KEYWORDS    RefSeq.
SOURCE      Cryptosporidium muris RN66
  ORGANISM  Cryptosporidium muris RN66
            Eukaryota; Sar; Alveolata; Apicomplexa; Conoidasida; Coccidia;
            Eucoccidiorida; Eimeriorina; Cryptosporidiidae; Cryptosporidium.
REFERENCE   1  (bases 1 to 372)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 372)
  AUTHORS   Lorenzi,H., Inman,J., Miller,J., Schobel,S., Amedeo,P., Caler,E.V.
            and da Silva,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUN-2008) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_002196574).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..372
                     /organism="Cryptosporidium muris RN66"
                     /mol_type="mRNA"
                     /strain="RN66"
                     /db_xref="taxon:441375"
                     /chromosome="Unknown"
     gene            <1..>372
                     /locus_tag="CMU_014790"
                     /db_xref="GeneID:6996218"
     CDS             1..372
                     /locus_tag="CMU_014790"
                     /note="encoded by transcript CMU_014790A;
                     weak similarity to SP:Q9UHV9: Prefoldin subunit 2.
                     taxon:9606 {Homo sapiens;}"
                     /codon_start=1
                     /product="prefoldin subunit 2, putative"
                     /protein_id="XP_002141152.1"
                     /db_xref="GeneID:6996218"
                     /translation="
MVETGYTKETQEEIVQLDKKLKLLNNKISELTQDSKEYGLVLNAFEKVDENRRCFRVIGGVMVERNVKTVKPALEKEKSALDSAISELEKQYESIEEEMKNLIEKYSTNSADPAQITSSSSSQ"
     misc_feature    25..318
                     /locus_tag="CMU_014790"
                     /note="prefoldin subunit 2; Region: Prefoldin_2; cd23163"
                     /db_xref="CDD:467479"
     misc_feature    25..144
                     /locus_tag="CMU_014790"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:467479"
     misc_feature    order(28..30,40..42,49..54,61..66,70..75,82..87,94..96,
                     256..258,265..267,277..279,289..291,298..303,310..315)
                     /locus_tag="CMU_014790"
                     /note="prefoldin beta subunit /TRiC interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:467479"
     misc_feature    order(121..123,130..132,142..147,154..174,178..195,
                     205..210,220..222)
                     /locus_tag="CMU_014790"
                     /note="prefoldin oligomer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:467479"
     misc_feature    202..318
                     /locus_tag="CMU_014790"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:467479"
ORIGIN      
atggttgagacaggatatactaaggagacacaagaagagattgttcaactagataagaaactcaaactactaaacaataagatttcagagcttactcaagatagtaaagagtatggtctagtcttaaatgcatttgagaaggtagacgagaaccgacgatgttttagagttattggtggtgtgatggttgagagaaatgttaaaactgttaaacctgctcttgaaaaagaaaagagtgcgttagatagtgcaatttccgaattagagaagcagtatgaatctattgaagaggaaatgaagaatctaattgagaaatatagtacaaatagtgctgatcctgcacaaataactagttcatcaagctcgcaataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]