ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-18 19:23:44, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_001879458 411 bp mRNA linear PLN 13-NOV-2023
DEFINITION Laccaria bicolor S238N-H82 uncharacterized protein
(LACBIDRAFT_325715), partial mRNA.
ACCESSION XM_001879458
VERSION XM_001879458.1
DBLINK BioProject: PRJNA29019
BioSample: SAMN02769624
KEYWORDS RefSeq.
SOURCE Laccaria bicolor S238N-H82
ORGANISM Laccaria bicolor S238N-H82
Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
Agaricomycetes; Agaricomycetidae; Agaricales; Agaricineae;
Hydnangiaceae; Laccaria.
REFERENCE 1 (bases 1 to 411)
AUTHORS Martin,F., Aerts,A., Ahren,D., Brun,A., Danchin,E.G.,
Duchaussoy,F., Gibon,J., Kohler,A., Lindquist,E., Pereda,V.,
Salamov,A., Shapiro,H.J., Wuyts,J., Blaudez,D., Buee,M.,
Brokstein,P., Canback,B., Cohen,D., Courty,P.E., Coutinho,P.M.,
Delaruelle,C., Detter,J.C., Deveau,A., DiFazio,S., Duplessis,S.,
Fraissinet-Tachet,L., Lucic,E., Frey-Klett,P., Fourrey,C.,
Feussner,I., Gay,G., Grimwood,J., Hoegger,P.J., Jain,P., Kilaru,S.,
Labbe,J., Lin,Y.C., Legue,V., Le Tacon,F., Marmeisse,R.,
Melayah,D., Montanini,B., Muratet,M., Nehls,U., Niculita-Hirzel,H.,
Oudot-Le Secq,M.P., Peter,M., Quesneville,H., Rajashekar,B.,
Reich,M., Rouhier,N., Schmutz,J., Yin,T., Chalot,M., Henrissat,B.,
Kues,U., Lucas,S., Van de Peer,Y., Podila,G.K., Polle,A.,
Pukkila,P.J., Richardson,P.M., Rouze,P., Sanders,I.R.,
Stajich,J.E., Tunlid,A., Tuskan,G. and Grigoriev,I.V.
TITLE The genome of Laccaria bicolor provides insights into mycorrhizal
symbiosis
JOURNAL Nature 452 (7183), 88-92 (2008)
PUBMED 18322534
REFERENCE 2 (bases 1 to 411)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (12-NOV-2023) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 411)
AUTHORS Zhou,K., Detter,J.C., Glavina del Rio,T., Dahlen,E., Tice,H.,
Pitluck,S., Aerts,A., Salamov,A., Shapiro,H.J., Lindquist,E.,
Lucas,S., Richardson,P.M., Ahren,D., Blaudez,D., Brun,A., Buee,M.,
Chalot,M., Courty,P., Coutinho,P.M., Deveau,A., Duplessis,S.,
Duchaussoy,F., Fourrey,C., Fraissinet-Tachet,L., Henrissat,B.,
Gay,G., Gibon,J., Hoegger,P., Kohler,A., Kues,U., Labbe,J.,
Muratet,M., Marmeisse,R., Melayah,D., Montanini,B., Napoli,C.,
Podila,G., Reich,M., Rouhier,N., Rouze,P., Wuyts,J., Martin,F. and
Grigoriev,I.V.
CONSRTM US DOE Joint Genome Institute (JGI-PGF)
TITLE Direct Submission
JOURNAL Submitted (19-NOV-2007) US DOE Joint Genome Institute, 2800
Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_001889879).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..411
/organism="Laccaria bicolor S238N-H82"
/mol_type="mRNA"
/strain="S238N-H82"
/db_xref="taxon:486041"
/chromosome="Unknown"
gene <1..>411
/locus_tag="LACBIDRAFT_325715"
/db_xref="GeneID:6074951"
CDS 1..411
/locus_tag="LACBIDRAFT_325715"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_001879493.1"
/db_xref="GeneID:6074951"
/translation="
MYSRSPWPVASPAAPLSSGNQSLLVIHGELPLASVLKYLDENCVDETNIVDGDTDVVNGDADVVNGDADVVNGDTDVDGDVDVVGVDTDGGTDVVDDDTNGGTDVVDGGTDTVGGDTDVEVEQSVRRPGREMIARA"
ORIGIN
atgtactctcggtctccatggcctgttgcatctcctgctgcaccactctcaagtggtaatcaatctcttcttgtcattcacggcgaacttcctcttgcctctgttctcaagtatttggatgagaattgtgtcgatgagaccaacattgtcgatggtgacacagacgtcgtcaatggtgacgcagacgtcgtcaatggtgacgcagatgtcgtcaatggtgacacagacgtcgacggtgatgtagacgtcgtcggtgttgacacagatggtggcacagacgtcgtcgatgatgacacaaatggtggcacagacgttgttgatggtggcacagacactgttggaggtgacacagacgtcgaggttgagcaaagtgtgagacgccctggaagggagatgattgcaagagcgtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]