2024-04-20 16:04:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_001805380 357 bp mRNA linear PLN 06-SEP-2017 DEFINITION Parastagonospora nodorum SN15 hypothetical protein (SNOG_15276), partial mRNA. ACCESSION XM_001805380 VERSION XM_001805380.1 DBLINK BioProject: PRJNA21049 BioSample: SAMN02953619 KEYWORDS RefSeq. SOURCE Parastagonospora nodorum SN15 ORGANISM Parastagonospora nodorum SN15 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporineae; Phaeosphaeriaceae; Parastagonospora. REFERENCE 1 (bases 1 to 357) AUTHORS Birren,B., Lander,E., Galagan,J., Devon,K., Nusbaum,C., Jaffe,D., Butler,J., Alvarez,P., Gnerre,S., Grabherr,M., Kleber,M., Mauceli,E., Brockman,W., Rounsley,S., Young,S., LaButti,K., Pushparaj,V., DeCaprio,D., Crawford,M., Koehrsen,M., Engels,R., Montgomery,P., Pearson,M., Howarth,C., Kodira,C., Zeng,Q., Yandava,C., Alvarado,L., Oleary,S., Oliver,R.O. and Solomon,P. CONSRTM The Broad Institute Genome Sequencing Platform TITLE Annotation of the Phaeosphaeria nodorum SN15 genome JOURNAL Unpublished REFERENCE 2 (bases 1 to 357) AUTHORS Hane,J.K., Lowe,R.G.T., Solomon,P.S., Tan,K.-C., Schoch,C.L., Spatafora,J.W., Crous,P.W., Kodira,C., Birren,B.W., Torriani,S.F.F., McDonald,B.A. and Oliver,R.P. TITLE Dothideomycete-plant interaction illuminated by genome sequencing and EST analysis of the wheat pathogen Stagonospora nodorum JOURNAL Unpublished REFERENCE 3 (bases 1 to 357) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (06-SEP-2017) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 4 (bases 1 to 357) AUTHORS Lander,E. and Birren,B. CONSRTM The Genome Sequencing Platform, The Genome Assembly Team TITLE Direct Submission JOURNAL Submitted (29-MAR-2005) Broad Institute of MIT and Harvard, 320 Charles Street, Cambridge, MA 02141, USA REFERENCE 5 (bases 1 to 357) AUTHORS Oliver,R.O. and Solomon,P. TITLE Direct Submission JOURNAL Submitted (29-MAR-2005) Murdoch University, South Street, Perth, WA 6150, Australia COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_001884585). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..357 /organism="Parastagonospora nodorum SN15" /mol_type="mRNA" /strain="SN15" /db_xref="taxon:321614" /chromosome="Unknown" gene <1..>357 /locus_tag="SNOG_15276" /note="gene prediction version 1" /db_xref="GeneID:5982360" CDS 1..357 /locus_tag="SNOG_15276" /note="gene prediction version 1" /codon_start=1 /product="hypothetical protein" /protein_id="XP_001805432.1" /db_xref="GeneID:5982360" /translation="
MSLDRSLTEAEKTRRNLSHALAPYLRRVAYFLSVHIDLSKTDAEQERGGCITTVRGIVTMKIDIEEWKQTDVLEVTLTSPSTSCVSGRAEVSVQCLVRTCAVSSEGAHIFCRSKAKAA"
ORIGIN
atgtcactggaccgcagtttgacggaggccgagaagacgcgccgaaacctcagccatgcactcgccccatacctgcgccgcgtggcttatttcctttctgtgcatattgatctctcaaagacagatgcagagcaggagaggggtggctgtatcactaccgtgcgtggcattgtaacgatgaagattgatatcgaagagtggaagcagacggatgttctagaggtcaccttgacctcgccgagcacatcttgtgtttccggtcgagctgaagtaagtgtacaatgtctggtcaggacgtgcgcagtctcttccgagggcgcacatatcttctgccgctccaaggccaaagcagcatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]