GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-20 16:04:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_001805380             357 bp    mRNA    linear   PLN 06-SEP-2017
DEFINITION  Parastagonospora nodorum SN15 hypothetical protein (SNOG_15276),
            partial mRNA.
ACCESSION   XM_001805380
VERSION     XM_001805380.1
DBLINK      BioProject: PRJNA21049
            BioSample: SAMN02953619
KEYWORDS    RefSeq.
SOURCE      Parastagonospora nodorum SN15
  ORGANISM  Parastagonospora nodorum SN15
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporineae;
            Phaeosphaeriaceae; Parastagonospora.
REFERENCE   1  (bases 1 to 357)
  AUTHORS   Birren,B., Lander,E., Galagan,J., Devon,K., Nusbaum,C., Jaffe,D.,
            Butler,J., Alvarez,P., Gnerre,S., Grabherr,M., Kleber,M.,
            Mauceli,E., Brockman,W., Rounsley,S., Young,S., LaButti,K.,
            Pushparaj,V., DeCaprio,D., Crawford,M., Koehrsen,M., Engels,R.,
            Montgomery,P., Pearson,M., Howarth,C., Kodira,C., Zeng,Q.,
            Yandava,C., Alvarado,L., Oleary,S., Oliver,R.O. and Solomon,P.
  CONSRTM   The Broad Institute Genome Sequencing Platform
  TITLE     Annotation of the Phaeosphaeria nodorum SN15 genome
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 357)
  AUTHORS   Hane,J.K., Lowe,R.G.T., Solomon,P.S., Tan,K.-C., Schoch,C.L.,
            Spatafora,J.W., Crous,P.W., Kodira,C., Birren,B.W.,
            Torriani,S.F.F., McDonald,B.A. and Oliver,R.P.
  TITLE     Dothideomycete-plant interaction illuminated by genome sequencing
            and EST analysis of the wheat pathogen Stagonospora nodorum
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 357)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 357)
  AUTHORS   Lander,E. and Birren,B.
  CONSRTM   The Genome Sequencing Platform, The Genome Assembly Team
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2005) Broad Institute of MIT and Harvard, 320
            Charles Street, Cambridge, MA 02141, USA
REFERENCE   5  (bases 1 to 357)
  AUTHORS   Oliver,R.O. and Solomon,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2005) Murdoch University, South Street, Perth, WA
            6150, Australia
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_001884585).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..357
                     /organism="Parastagonospora nodorum SN15"
                     /mol_type="mRNA"
                     /strain="SN15"
                     /db_xref="taxon:321614"
                     /chromosome="Unknown"
     gene            <1..>357
                     /locus_tag="SNOG_15276"
                     /note="gene prediction version 1"
                     /db_xref="GeneID:5982360"
     CDS             1..357
                     /locus_tag="SNOG_15276"
                     /note="gene prediction version 1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001805432.1"
                     /db_xref="GeneID:5982360"
                     /translation="
MSLDRSLTEAEKTRRNLSHALAPYLRRVAYFLSVHIDLSKTDAEQERGGCITTVRGIVTMKIDIEEWKQTDVLEVTLTSPSTSCVSGRAEVSVQCLVRTCAVSSEGAHIFCRSKAKAA"
ORIGIN      
atgtcactggaccgcagtttgacggaggccgagaagacgcgccgaaacctcagccatgcactcgccccatacctgcgccgcgtggcttatttcctttctgtgcatattgatctctcaaagacagatgcagagcaggagaggggtggctgtatcactaccgtgcgtggcattgtaacgatgaagattgatatcgaagagtggaagcagacggatgttctagaggtcaccttgacctcgccgagcacatcttgtgtttccggtcgagctgaagtaagtgtacaatgtctggtcaggacgtgcgcagtctcttccgagggcgcacatatcttctgccgctccaaggccaaagcagcatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]